Recombinant Human Chitotriosidase/CHIT1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Chitotriosidase/CHIT1 Peptides and Proteins

Order Details


    • Catalog Number
      H00001118-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Chitotriosidase/CHIT1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-110 of Human CHIT1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQE

Protein/Peptide Type
Partial Recombinant Protein
Gene
CHIT1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Chitotriosidase/CHIT1 Protein

  • CHI3
  • CHIT1
  • CHITCHI3
  • chitinase 1 (chitotriosidase)
  • chitinase-1
  • Chitotriosidase
  • chitotriosidase-1
  • EC 3.2.1.14
  • FLJ00314
  • MGC125322
  • plasma methylumbelliferyl tetra-N-acetylchitotetraoside hydrolase

Background

Chitotriosidase is secreted by activated human macrophages and is markedly elevated in plasma of Gaucher disease patients. The expression of chitotriosidase occurs only at a late stage of differentiation of monocytes to activated macrophages in culture. Human macrophages can synthesize a functional chitotriosidase, a highly conserved enzyme with a strongly regulated expression. This enzyme may play a role in the degradation of chitin-containing pathogens. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32440
Species: Hu
Applications: IHC, IHC-P
NBP1-32907
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-85842
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2599
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-22568
Species: Hu
Applications: IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-04611
Species: Hu
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
366-6C/CF
Species: Hu
NBP1-40974
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IP
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00001118-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Chitotriosidase/CHIT1 Partial Recombinant Protein (H00001118-Q01) (0)

There are no publications for Chitotriosidase/CHIT1 Partial Recombinant Protein (H00001118-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chitotriosidase/CHIT1 Partial Recombinant Protein (H00001118-Q01) (0)

There are no reviews for Chitotriosidase/CHIT1 Partial Recombinant Protein (H00001118-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Chitotriosidase/CHIT1 Partial Recombinant Protein (H00001118-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Chitotriosidase/CHIT1 Products

Bioinformatics Tool for Chitotriosidase/CHIT1 Partial Recombinant Protein (H00001118-Q01)

Discover related pathways, diseases and genes to Chitotriosidase/CHIT1 Partial Recombinant Protein (H00001118-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Chitotriosidase/CHIT1 Partial Recombinant Protein (H00001118-Q01)

Discover more about diseases related to Chitotriosidase/CHIT1 Partial Recombinant Protein (H00001118-Q01).
 

Pathways for Chitotriosidase/CHIT1 Partial Recombinant Protein (H00001118-Q01)

View related products by pathway.

Blogs on Chitotriosidase/CHIT1

There are no specific blogs for Chitotriosidase/CHIT1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Chitotriosidase/CHIT1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CHIT1
Entrez