CHIP/STUB1 Antibody


Western Blot: CHIP/STUB1 Antibody [NBP1-53139] - Lanes: 1 : 1ug insoluble STUB1 protein, 2: 1ug soluble STUB1 protein, 3: 1ug EPM2A protein, 4: 1ug insoluble PPP1R3C protein, 5: 1ug soluble PPP1R3C protein Primary more
Immunocytochemistry/ Immunofluorescence: CHIP/STUB1 Antibody [NBP1-53139] - Mouse Brain Slices, Red: Primary (1:400) Blue: DAPI Secondary: Anti-Rabbit IgG Alexa 594 (1:400)
Western Blot: CHIP/STUB1 Antibody [NBP1-53139] - Titration: 0.2-1 ug/ml, Positive Control: Human Spleen.

Product Details

Product Discontinued
View other related CHIP/STUB1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CHIP/STUB1 Antibody Summary

Synthetic peptides corresponding to STUB1(STIP1 homology and U-box containing protein 1) The peptide sequence was selected from the N terminal of STUB1. Peptide sequence MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against STUB1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CHIP/STUB1 Antibody

  • Antigen NY-CO-7
  • Carboxy terminus of Hsp70-interacting protein
  • CHIP
  • CHIPSTIP1 homology and U box-containing protein 1
  • CLL-associated antigen KW-8
  • E3 ubiquitin-protein ligase CHIP
  • EC 6.3.2.-
  • heat shock protein A binding protein 2 (c-terminal)
  • NY-CO-7
  • serologically defined colon cancer antigen 7
  • STIP1 homology and U-box containing protein 1
  • STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase
  • STUB1
  • UBOX1


STUB1 modulates the activity of several chaperone complexes, including Hsp70, Hsc70 and Hsp90. It has E3 ubiquitin-protein ligase activity and targets misfolded chaperone substrates towards proteasomal degradation. STUB1 mediates transfer of non-canonical short ubiquitin chains to HSPA8 that have no effect on HSPA8 degradation.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Rb, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Pm
Applications: WB, IHC, IHC-P

Publications for CHIP/STUB1 Antibody (NBP1-53139) (0)

There are no publications for CHIP/STUB1 Antibody (NBP1-53139).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHIP/STUB1 Antibody (NBP1-53139) (0)

There are no reviews for CHIP/STUB1 Antibody (NBP1-53139). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CHIP/STUB1 Antibody (NBP1-53139) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CHIP/STUB1 Products

Bioinformatics Tool for CHIP/STUB1 Antibody (NBP1-53139)

Discover related pathways, diseases and genes to CHIP/STUB1 Antibody (NBP1-53139). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHIP/STUB1 Antibody (NBP1-53139)

Discover more about diseases related to CHIP/STUB1 Antibody (NBP1-53139).

Pathways for CHIP/STUB1 Antibody (NBP1-53139)

View related products by pathway.

PTMs for CHIP/STUB1 Antibody (NBP1-53139)

Learn more about PTMs related to CHIP/STUB1 Antibody (NBP1-53139).

Research Areas for CHIP/STUB1 Antibody (NBP1-53139)

Find related products by research area.

Blogs on CHIP/STUB1

There are no specific blogs for CHIP/STUB1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CHIP/STUB1 Antibody and receive a gift card or discount.


Gene Symbol STUB1