Recombinant Human CHIC2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CHIC2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 21-84 of Human CHIC2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CHIC2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CHIC2 Protein

  • BTLBrX-like translocated in leukemia
  • cysteine-rich hydrophobic domain 2 protein
  • cysteine-rich hydrophobic domain 2
  • cystein-rich hydrophobic domain 2
  • MGC21173

Background

CHIC2 - cysteine-rich hydrophobic domain 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85064
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
AF1062
Species: Mu
Applications: WB, IHC, Neut
NBP2-45545
Species: Hu
Applications: WB, IHC
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-81925
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-31695
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58844
Species: Hu
Applications: ICC/IF
NBP1-89483
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007071-M15
Species: Hu, Mu, Rt
Applications: WB, ELISA
AF5414
Species: Hu
Applications: WB, Simple Western
H00000027-M03
Species: Hu
Applications: WB, ELISA, PLA, RNAi
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00026511-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for CHIC2 Partial Recombinant Protein (H00026511-Q01) (0)

There are no publications for CHIC2 Partial Recombinant Protein (H00026511-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHIC2 Partial Recombinant Protein (H00026511-Q01) (0)

There are no reviews for CHIC2 Partial Recombinant Protein (H00026511-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHIC2 Partial Recombinant Protein (H00026511-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CHIC2 Products

Bioinformatics Tool for CHIC2 Partial Recombinant Protein (H00026511-Q01)

Discover related pathways, diseases and genes to CHIC2 Partial Recombinant Protein (H00026511-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHIC2 Partial Recombinant Protein (H00026511-Q01)

Discover more about diseases related to CHIC2 Partial Recombinant Protein (H00026511-Q01).
 

Pathways for CHIC2 Partial Recombinant Protein (H00026511-Q01)

View related products by pathway.

PTMs for CHIC2 Partial Recombinant Protein (H00026511-Q01)

Learn more about PTMs related to CHIC2 Partial Recombinant Protein (H00026511-Q01).

Blogs on CHIC2

There are no specific blogs for CHIC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CHIC2 Antibody
NBP1-32719

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CHIC2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CHIC2