CHIA Antibody

Images

 
Immunohistochemistry: CHIA Antibody [NBP2-32440] - Staining of stomach.
Immunohistochemistry: CHIA Antibody [NBP2-32440] - Staining of human stomach, upper shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry: CHIA Antibody [NBP2-32440] - Staining of stomach.
Immunohistochemistry: CHIA Antibody [NBP2-32440] - Staining of stomach cancer.
Immunohistochemistry: CHIA Antibody [NBP2-32440] - Staining of human stomach, upper shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry: CHIA Antibody [NBP2-32440] - Staining of stomach cancer.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHIA Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHIA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CHIA Protein (NBP2-32440PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHIA Antibody

  • acidic mammalian chitinase
  • AMCASE
  • CHIT2DKFZp313J1722
  • chitinase, acidic
  • EC 3.2.1.14
  • Lung-specific protein TSA1902
  • TSA1902AMCase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2599
Species: Hu
Applications: WB, Simple Western, IHC
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-84490
Species: Hu
Applications: WB, IHC, IHC-P
MAB653
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF2599
Species: Hu
Applications: WB, Simple Western, IHC
NB200-204
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
DDX0490P-100
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-32440
Species: Hu
Applications: IHC, IHC-P

Publications for CHIA Antibody (NBP2-32440) (0)

There are no publications for CHIA Antibody (NBP2-32440).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHIA Antibody (NBP2-32440) (0)

There are no reviews for CHIA Antibody (NBP2-32440). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CHIA Antibody (NBP2-32440) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHIA Products

Bioinformatics Tool for CHIA Antibody (NBP2-32440)

Discover related pathways, diseases and genes to CHIA Antibody (NBP2-32440). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHIA Antibody (NBP2-32440)

Discover more about diseases related to CHIA Antibody (NBP2-32440).
 

Pathways for CHIA Antibody (NBP2-32440)

View related products by pathway.

PTMs for CHIA Antibody (NBP2-32440)

Learn more about PTMs related to CHIA Antibody (NBP2-32440).

Blogs on CHIA

There are no specific blogs for CHIA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHIA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHIA