CHD4 Antibody (0M3R5)

Western Blot: CHD4 Antibody (0M3R5) [NBP3-33432] - Western blot analysis of lysates from HeLa cells using CHD4 Rabbit mAb at 1:20000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

Immunohistochemistry: CHD4 Antibody (0M3R5) [NBP3-33432] - Immunohistochemistry analysis of paraffin-embedded Human spleen using CHD4 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: CHD4 Antibody (0M3R5) [NBP3-33432] - Immunohistochemistry analysis of paraffin-embedded Human liver using CHD4 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Western Blot: CHD4 Antibody (0M3R5) [NBP3-33432] - Western blot analysis of lysates from HeLa cells using CHD4 Rabbit mAb at 1:20000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

• Reactivity: Hu, Mu, Rt
• Applications: ELISA, IHC
• Clone: 0M3R5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CHD4 Antibody (0M3R5) Summary

• Description: Novus Biologicals Rabbit CHD4 Antibody (0M3R5) (NBP3-33432) is a monoclonal antibody validated for use in IHC and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1520-1700 of human CHD4 (NP_001264.2).
  
  Sequence:
  ELAEVEENKKMSQPGSPSPKTPTPSTPGDTQPNTPAPVPPAEDGIKIEENSLKEEESIEGEKEVKSTAPETAIECTQAPAPASEDEKVVVEPPEGEEKVEKAEVKERTEEPMETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNI
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CHD4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Theoretical MW: 218 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for CHD4 Antibody (0M3R5)

• ATP-dependent helicase CHD4
• CHD-4
• chromodomain helicase DNA binding protein 4
• chromodomain-helicase-DNA-binding protein 4
• DKFZp686E06161
• EC 3.6.1
• EC 3.6.4.12
• Mi-2 autoantigen 218 kDa protein
• Mi-2b
• Mi2-BETA

Background

CHD4/Mi2beta is a helicase component of the nucleosome remodeling and deacetylase (NuRD) complex that functions to remodel chromatin and repress transcription. Outside of the NuRD complex, CHD4/Mi2beta can function as an activator of transcription in association with p300 histone acetyltransferase. Alternate names for CHD4/Mi2beta include chromodomain-helicase-DNA-binding protein 4, CHD-4, ATP-dependent helicase CHD4, Mi-2 autoantigen 218 kDa protein, Mi2-beta, Mi-2b, and DKFZp686E06161.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHD4