CGI 62 Antibody


Western Blot: CGI 62 Antibody [NBP1-88246] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: CGI 62 Antibody [NBP1-88246] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: CGI 62 Antibody [NBP1-88246] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Western Blot: CGI 62 Antibody [NBP1-88246] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

CGI 62 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TYTESYIARPDGDCASSLNGGNIKGIEGHSPGNLPKFCHECGTKYPVEWAKFCCECGIRRMIL
Specificity of human, mouse, rat CGI 62 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CGI 62 Protein (NBP1-88246PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CGI 62 Antibody

  • C8orf70
  • CGI-62
  • chromosome 8 open reading frame 70
  • family with sequence similarity 164, member A
  • hypothetical protein LOC51101


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, ELISA(Sta)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, IHC, Block, CyTOF-ready
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Pm, Mu(-)
Applications: WB, Flow, IHC, IHC-P, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CGI 62 Antibody (NBP1-88246) (0)

There are no publications for CGI 62 Antibody (NBP1-88246).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CGI 62 Antibody (NBP1-88246) (0)

There are no reviews for CGI 62 Antibody (NBP1-88246). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CGI 62 Antibody (NBP1-88246) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional CGI 62 Products

Bioinformatics Tool for CGI 62 Antibody (NBP1-88246)

Discover related pathways, diseases and genes to CGI 62 Antibody (NBP1-88246). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CGI 62

There are no specific blogs for CGI 62, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CGI 62 Antibody and receive a gift card or discount.


Gene Symbol ZC2HC1A