CGGBP1 Antibody (1D11) [DyLight 680]

Images

 

Product Details

Summary
Product Discontinued
View other related CGGBP1 Primary Antibodies

Order Details


    • Catalog Number
      H00008545-M02FR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CGGBP1 Antibody (1D11) [DyLight 680] Summary

Immunogen
CGGBP1 (NP_003654, 58 a.a. - 167 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC
Specificity
CGGBP1 - CGG triplet repeat binding protein 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CGGBP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CGGBP1 Antibody (1D11) [DyLight 680]

  • 20 kDa CGG-binding protein
  • CGG triplet repeat binding protein 1
  • CGG triplet repeat-binding protein 1
  • CGG-binding protein 1
  • CGGBPp20-CGGBP
  • p20-CGG binding protein
  • p20-CGGBP DNA-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-31913
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NB100-65125
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
1670-SE
Species: Ec
H00007541-M02
Species: Hu
Applications: WB, ELISA
AF3827
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP2-20212
Species: Hu
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56555
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Pm, Xp
Applications: WB
AF2790
Species: Hu
Applications: WB
NBP1-81480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7635
Species: Hu
Applications: WB
H00084107-M09
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF756
Species: Mu
Applications: WB, IHC
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33479
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-86641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
H00008545-M02FR
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for CGGBP1 Antibody (H00008545-M02FR) (0)

There are no publications for CGGBP1 Antibody (H00008545-M02FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CGGBP1 Antibody (H00008545-M02FR) (0)

There are no reviews for CGGBP1 Antibody (H00008545-M02FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CGGBP1 Antibody (H00008545-M02FR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CGGBP1 Products

Bioinformatics Tool for CGGBP1 Antibody (H00008545-M02FR)

Discover related pathways, diseases and genes to CGGBP1 Antibody (H00008545-M02FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CGGBP1 Antibody (H00008545-M02FR)

Discover more about diseases related to CGGBP1 Antibody (H00008545-M02FR).
 

Pathways for CGGBP1 Antibody (H00008545-M02FR)

View related products by pathway.

PTMs for CGGBP1 Antibody (H00008545-M02FR)

Learn more about PTMs related to CGGBP1 Antibody (H00008545-M02FR).

Blogs on CGGBP1

There are no specific blogs for CGGBP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CGGBP1 Antibody (1D11) [DyLight 680] and receive a gift card or discount.

Bioinformatics

Gene Symbol CGGBP1