Recombinant Human CES2 Protein (H00008824-Q01)

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CES2 Protein Summary

Description
CES2 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PPHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKYWANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERHT
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
CES2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CES2 Protein

  • carboxylesterase 2 (intestine, liver)
  • carboxylesterase 2EC 3.1.1.1
  • CE-2PCE-2
  • CES2A1
  • EC 3.1.1
  • EC 3.1.1.84
  • hCE-2
  • iCE
  • intestinal carboxylesterase; liver carboxylesterase-2

Background

CES2 - carboxylesterase 2 (intestine, liver)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45867
Species: Hu
Applications: WB, Flow, IHC
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-83910
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
H00004502-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for CES2 Partial Recombinant Protein (H00008824-Q01) (0)

There are no publications for CES2 Partial Recombinant Protein (H00008824-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CES2 Partial Recombinant Protein (H00008824-Q01) (0)

There are no reviews for CES2 Partial Recombinant Protein (H00008824-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CES2 Partial Recombinant Protein (H00008824-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CES2 Products

Related Products by Gene

Bioinformatics Tool for CES2 Partial Recombinant Protein (H00008824-Q01)

Discover related pathways, diseases and genes to CES2 Partial Recombinant Protein (H00008824-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CES2 Partial Recombinant Protein (H00008824-Q01)

Discover more about diseases related to CES2 Partial Recombinant Protein (H00008824-Q01).
 

Pathways for CES2 Partial Recombinant Protein (H00008824-Q01)

View related products by pathway.

PTMs for CES2 Partial Recombinant Protein (H00008824-Q01)

Learn more about PTMs related to CES2 Partial Recombinant Protein (H00008824-Q01).
 

Research Areas for CES2 Partial Recombinant Protein (H00008824-Q01)

Find related products by research area.

Blogs on CES2

There are no specific blogs for CES2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CES2 Antibody
NBP1-84556
CES2 Antibody
NBP1-84556
CES2 Antibody
NBP1-84556

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CES2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CES2