CES1 Antibody

Images

 
Western Blot: CES1 Antibody [NBP1-85691] - Analysis in human cell line HepG2.
Immunohistochemistry-Paraffin: CES1 Antibody [NBP1-85691] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Simple Western: CES1 Antibody [NBP1-85691] - Simple Western lane view shows a specific band for CES1 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation ...read more
Simple Western: CES1 Antibody [NBP1-85691] - Electropherogram image(s) of corresponding Simple Western lane view. CES1 antibody was used at 1:20 dilution on RT-4 lysate(s).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CES1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CES1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:20
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
CES1 Protein (NBP1-85691PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CES1 Antibody

  • ACAT
  • acyl coenzyme A:cholesterol acyltransferase
  • Acyl-coenzyme A:cholesterol acyltransferase
  • Brain carboxylesterase hBr1
  • carboxylesterase 1 (monocyte/macrophage serine esterase 1)
  • carboxylesterase 1
  • carboxylesterase 2 (liver)
  • CEH
  • CES1A2
  • CES2EC 3.1.1.1
  • cholesteryl ester hydrolase
  • Cocaine carboxylesterase
  • EC 3.1.1
  • egasyn
  • HMSE1
  • HMSECES1A1
  • human monocyte/macrophage serine esterase 1
  • liver carboxylesterase 1
  • MGC117365
  • Monocyte/macrophage serine esterase
  • PCE-1
  • REH
  • Retinyl ester hydrolase
  • Serine esterase 1
  • SES1TGH
  • Triacylglycerol hydrolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54155
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP2-45981
Species: Hu
Applications: IHC
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB9120
Species: Hu
Applications: ICC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-02588
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47529
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05950
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P

Publications for CES1 Antibody (NBP1-85691) (0)

There are no publications for CES1 Antibody (NBP1-85691).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CES1 Antibody (NBP1-85691) (0)

There are no reviews for CES1 Antibody (NBP1-85691). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CES1 Antibody (NBP1-85691) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CES1 Products

Bioinformatics Tool for CES1 Antibody (NBP1-85691)

Discover related pathways, diseases and genes to CES1 Antibody (NBP1-85691). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CES1 Antibody (NBP1-85691)

Discover more about diseases related to CES1 Antibody (NBP1-85691).
 

Pathways for CES1 Antibody (NBP1-85691)

View related products by pathway.

PTMs for CES1 Antibody (NBP1-85691)

Learn more about PTMs related to CES1 Antibody (NBP1-85691).

Blogs on CES1

There are no specific blogs for CES1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CES1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CES1