Cerebellin-1/Precerebellin Antibody


Western Blot: Precerebellin Antibody [NBP1-69133] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related Cerebellin-1/Precerebellin Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Cerebellin-1/Precerebellin Antibody Summary

Synthetic peptides corresponding to CBLN1 (cerebellin 1 precursor) The peptide sequence was selected from the C terminal of CBLN1. Peptide sequence LMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGW.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CBLN1 and was validated on Western blot.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cerebellin-1/Precerebellin Antibody

  • CBLN1
  • cerebellin 1 precursor
  • Cerebellin1
  • Cerebellin-1
  • CLN1
  • Precerebellin


This gene encodes a cerebellum-specific precursor protein, precerebellin, with similarity to the globular (non-collagen-like) domain of complement component C1qB. Precerebellin is processed to give rise to several derivatives, including the hexadecapeptide, cerebellin, which is highly enriched in postsynaptic structures of Purkinje cells. Cerebellin has also been found in human and rat adrenals, where it has been shown to enhance the secretory activity of this gland.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
Species: Hu, Ca
Applications: WB, IHC, ICC
Species: Hu, Ye
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB

Publications for Cerebellin-1/Precerebellin Antibody (NBP1-69133) (0)

There are no publications for Cerebellin-1/Precerebellin Antibody (NBP1-69133).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cerebellin-1/Precerebellin Antibody (NBP1-69133) (0)

There are no reviews for Cerebellin-1/Precerebellin Antibody (NBP1-69133). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cerebellin-1/Precerebellin Antibody (NBP1-69133) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Cerebellin-1/Precerebellin Products

Bioinformatics Tool for Cerebellin-1/Precerebellin Antibody (NBP1-69133)

Discover related pathways, diseases and genes to Cerebellin-1/Precerebellin Antibody (NBP1-69133). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cerebellin-1/Precerebellin Antibody (NBP1-69133)

Discover more about diseases related to Cerebellin-1/Precerebellin Antibody (NBP1-69133).

Pathways for Cerebellin-1/Precerebellin Antibody (NBP1-69133)

View related products by pathway.

PTMs for Cerebellin-1/Precerebellin Antibody (NBP1-69133)

Learn more about PTMs related to Cerebellin-1/Precerebellin Antibody (NBP1-69133).

Blogs on Cerebellin-1/Precerebellin

There are no specific blogs for Cerebellin-1/Precerebellin, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cerebellin-1/Precerebellin Antibody and receive a gift card or discount.


Gene Symbol CBLN1