CENPM Antibody (4C12-2C8) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related CENPM Primary Antibodies

Order Details


    • Catalog Number
      H00079019-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CENPM Antibody (4C12-2C8) [DyLight 488] Summary

Immunogen
C22orf18 (AAH00705, 1 a.a. ~ 181 a.a) full length recombinant protein with GST tag.MSVLRPLDKLPGLNTATILLVGTEDALLQQLADSMLKEDCAS ELKVHLAKSLPLPSSVNRPRIDLIVFVVNLHSKYSLQNTEES LRHVDASFFLGKVCFLATGAGRESHCSIHRHTVVKLAHTYQS PLLYCDLEVEGFRATMAQRLVRVLQICAGHVPGVSALNLLSL LRSSEGPSLEDL
Localization
Cytoplasmic and Nuclear. Note: Nuclear in non confluent cells and cytoplasmic in confluent or dividing cells. Localizes in the kinetochore domain of centromeres.
Specificity
C22orf18 - chromosome 22 open reading frame 18
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CENPM
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CENPM Antibody (4C12-2C8) [DyLight 488]

  • bK250D10.2
  • C22orf18PANE1MGC861
  • CENP-Mchromosome 22 open reading frame 18
  • centromere protein M
  • ICEN39
  • Interphase centromere complex protein 39
  • Pane1
  • proliferation associated nuclear element 1
  • Proliferation-associated nuclear element protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NBP2-34093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00378708-B01P
Species: Hu
Applications: WB, ELISA
NBP1-79664
Species: Hu
Applications: WB, ICC/IF
NBP1-82546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88485
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85688
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-55216
Species: Hu
Applications: WB
NBP2-15245
Species: Hu, Mu, Rt, Ch
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00002491-B01P
Species: Hu
Applications: WB, ICC/IF
H00064105-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-76240
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-2369
Species: Hu
Applications: ICC/IF, IHC
NBP1-54899
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-55474
Species: Hu
Applications: ICC/IF
NBP1-85687
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CENPM Antibody (H00079019-M01G) (0)

There are no publications for CENPM Antibody (H00079019-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CENPM Antibody (H00079019-M01G) (0)

There are no reviews for CENPM Antibody (H00079019-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CENPM Antibody (H00079019-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CENPM Products

Bioinformatics Tool for CENPM Antibody (H00079019-M01G)

Discover related pathways, diseases and genes to CENPM Antibody (H00079019-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CENPM

There are no specific blogs for CENPM, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CENPM Antibody (4C12-2C8) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol CENPM