CENPA Antibody


Western Blot: CENPA Antibody [NBP1-53046] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml CENPA is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Western Blot: CENPA Antibody [NBP1-53046] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related CENPA Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CENPA Antibody Summary

Synthetic peptides corresponding to CENPA(centromere protein A) The peptide sequence was selected from the middle region of CENPA. Peptide sequence ALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG.
Centromeres Marker
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CENPA and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CENPA Antibody

  • Centromere autoantigen A
  • centromere protein A (17kD)
  • centromere protein ACENP-Acentromere protein A, 17kDa
  • histone H3-like centromeric protein A


Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. CENPA is a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. CENPA is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle.Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. CENPA encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. CENPA is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. Alternative splicing results in multiple transcript variants encoding distinct isoforms.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF
Species: Hu
Applications: ICC/IF, IHC
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Po, Ha, Mk
Applications: WB, Flow, ICC/IF, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: ELISA, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu
Applications: WB

Publications for CENPA Antibody (NBP1-53046) (0)

There are no publications for CENPA Antibody (NBP1-53046).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CENPA Antibody (NBP1-53046) (0)

There are no reviews for CENPA Antibody (NBP1-53046). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CENPA Antibody (NBP1-53046) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CENPA Products

Bioinformatics Tool for CENPA Antibody (NBP1-53046)

Discover related pathways, diseases and genes to CENPA Antibody (NBP1-53046). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CENPA Antibody (NBP1-53046)

Discover more about diseases related to CENPA Antibody (NBP1-53046).

Pathways for CENPA Antibody (NBP1-53046)

View related products by pathway.

PTMs for CENPA Antibody (NBP1-53046)

Learn more about PTMs related to CENPA Antibody (NBP1-53046).

Blogs on CENPA

There are no specific blogs for CENPA, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CENPA Antibody and receive a gift card or discount.


Gene Symbol CENPA