CELSR1 Antibody


Immunocytochemistry/ Immunofluorescence: CELSR1 Antibody [NBP2-55658] - Staining of human cell line A549 shows localization to plasma membrane.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

CELSR1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PTSFRLQILNNYLQFEVSHGPSDVESVMLSGLRVTDGEWHHLLIELKNVKEDSEMKHLVTMTLDYGMDQNKADIGGMLPGLTVRSVVV
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CELSR1 Recombinant Protein Antigen (NBP2-55658PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for CELSR1 Antibody

  • cadherin, EGF LAG seven-pass G-type receptor 1 (flamingo homolog, Drosophila)
  • DKFZp434P0729
  • flamingo homolog 2
  • FMI2
  • HFMI2
  • ME2
  • protocadherin flamingo 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, ELISA, S-ELISA
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: CyTOF-ready, ICFlow

Publications for CELSR1 Antibody (NBP2-55658) (0)

There are no publications for CELSR1 Antibody (NBP2-55658).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CELSR1 Antibody (NBP2-55658) (0)

There are no reviews for CELSR1 Antibody (NBP2-55658). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CELSR1 Antibody (NBP2-55658) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional CELSR1 Products

Bioinformatics Tool for CELSR1 Antibody (NBP2-55658)

Discover related pathways, diseases and genes to CELSR1 Antibody (NBP2-55658). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CELSR1 Antibody (NBP2-55658)

Discover more about diseases related to CELSR1 Antibody (NBP2-55658).

Pathways for CELSR1 Antibody (NBP2-55658)

View related products by pathway.

PTMs for CELSR1 Antibody (NBP2-55658)

Learn more about PTMs related to CELSR1 Antibody (NBP2-55658).

Research Areas for CELSR1 Antibody (NBP2-55658)

Find related products by research area.

Blogs on CELSR1

There are no specific blogs for CELSR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CELSR1 Antibody and receive a gift card or discount.


Gene Symbol CELSR1