CEACAM1/CD66a Antibody (2F10)

Images

 
Sandwich ELISA: CEACAM-1/CD66a Antibody (2F10) [H00000634-M01] - Detection limit for recombinant GST tagged CEACAM1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2F10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CEACAM1/CD66a Antibody (2F10) Summary

Immunogen
CEACAM1 (AAH14473 305 a.a. - 414 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNV
Specificity
CEACAM1 - carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CEACAM1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CEACAM1/CD66a Antibody (2F10)

  • antigen CD66
  • BGP1
  • BGP-1
  • BGP1BGPBiliary glycoprotein 1
  • BGPI
  • Biliary Glycoprotein 1
  • biliary glycoprotein adhesion molecule
  • carcinoembryonic antigen-related cell adhesion molecule 1 (biliaryglycoprotein)
  • carcinoembryonic antigen-related cell adhesion molecule 1
  • CD66a antigen
  • CD66a
  • Cea-1
  • CEACAM1
  • CEACAM-1
  • Hv-1
  • Hv-2
  • MHVR

Background

This gene encodes a member of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily. Two subgroups of the CEA family, the CEA cell adhesion molecules and the pregnancy-specific glycoproteins, are located within a 1.2 Mb cluster on the long arm of chromosome 19. Eleven pseudogenes of the CEA cell adhesion molecule subgroup are also found in the cluster. The encoded protein was originally described in bile ducts of liver as biliary glycoprotein. Subsequently, it was found to be a cell-cell adhesion molecule detected on leukocytes, epithelia, and endothelia. The encoded protein mediates cell adhesion via homophilic as well as heterophilic binding to other proteins of the subgroup. Multiple cellular activities have been attributed to the encoded protein, including roles in the differentiation and arrangement of tissue three-dimensional structure, angiogenesis, apoptosis, tumor suppression, metastasis, and the modulation of innate and adaptive immune responses. Multiple transcript variants encoding different isoforms have been reported, but the full-length nature of only two has been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-47863
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6146
Species: Hu
Applications: ICC
NBP2-35213
Species: Hu
NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
H00005670-T01
Species: Hu
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
MAB3934
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-42378
Species: Hu
Applications: WB, IHC
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00000634-M01
Species: Hu
Applications: ELISA

Publications for CEACAM1/CD66a Antibody (H00000634-M01) (0)

There are no publications for CEACAM1/CD66a Antibody (H00000634-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEACAM1/CD66a Antibody (H00000634-M01) (0)

There are no reviews for CEACAM1/CD66a Antibody (H00000634-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CEACAM1/CD66a Antibody (H00000634-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CEACAM1/CD66a Products

Bioinformatics Tool for CEACAM1/CD66a Antibody (H00000634-M01)

Discover related pathways, diseases and genes to CEACAM1/CD66a Antibody (H00000634-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEACAM1/CD66a Antibody (H00000634-M01)

Discover more about diseases related to CEACAM1/CD66a Antibody (H00000634-M01).
 

Pathways for CEACAM1/CD66a Antibody (H00000634-M01)

View related products by pathway.

PTMs for CEACAM1/CD66a Antibody (H00000634-M01)

Learn more about PTMs related to CEACAM1/CD66a Antibody (H00000634-M01).
 

Research Areas for CEACAM1/CD66a Antibody (H00000634-M01)

Find related products by research area.

Blogs on CEACAM1/CD66a

There are no specific blogs for CEACAM1/CD66a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEACAM1/CD66a Antibody (2F10) and receive a gift card or discount.

Bioinformatics

Gene Symbol CEACAM1
Entrez
OMIM
Uniprot