Recombinant Human CDYL Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CDYL Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 153-260 of Human CDYL partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LVIGKDHESKNSQLFAASQKFRKNTAPSLSSRKNMDLAKSGIKILVPKSPVKSRTAVDGFQSESPEKLDPVEQGQEDTVAPEVAAEKPVGALLGPGAERARMGSRPRI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CDYL
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CDYL Protein

  • CDYL1bA620A17.2 (chromodomain protein, Y chromosome-like)
  • CDY-like
  • CDY-like, autosomal
  • chromodomain protein, Y chromosome-like
  • chromodomain protein, Y-like
  • chromodomain Y-like protein
  • DKFZP586C1622
  • EC 2.3.1.48
  • MGC131936
  • testis-specific chromodomain Y-like protein

Background

Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene. Proteins encoded by this gene superfamily possess a chromodomain, a motif implicated in chromatin binding and gene suppression, and a catalytic domain believed to be involved in histone acetylation. Multiple proteins are encoded by transcript variants of this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009426-R01
Species: Hu
PP-A8620A-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
NBP1-83470
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB600-240
Species: Hu
Applications: WB, IHC-P, PLA
NBP1-80586
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-757
Species: Hu
Applications: WB, IHC-P
NB100-61070
Species: Hu
Applications: WB (-), IP
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11569
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NB110-40623
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-07996
Species: Hu
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF

Publications for CDYL Partial Recombinant Protein (H00009425-Q01) (0)

There are no publications for CDYL Partial Recombinant Protein (H00009425-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDYL Partial Recombinant Protein (H00009425-Q01) (0)

There are no reviews for CDYL Partial Recombinant Protein (H00009425-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDYL Partial Recombinant Protein (H00009425-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDYL Products

Bioinformatics Tool for CDYL Partial Recombinant Protein (H00009425-Q01)

Discover related pathways, diseases and genes to CDYL Partial Recombinant Protein (H00009425-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDYL Partial Recombinant Protein (H00009425-Q01)

Discover more about diseases related to CDYL Partial Recombinant Protein (H00009425-Q01).
 

Pathways for CDYL Partial Recombinant Protein (H00009425-Q01)

View related products by pathway.

PTMs for CDYL Partial Recombinant Protein (H00009425-Q01)

Learn more about PTMs related to CDYL Partial Recombinant Protein (H00009425-Q01).

Blogs on CDYL

There are no specific blogs for CDYL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CDYL Antibody
NBP2-34011
HDAC1 Antibody
NB100-56340

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CDYL Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDYL