CDR2 Antibody



Product Details

Product Discontinued
View other related CDR2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CDR2 Antibody Summary

Synthetic peptides corresponding to CDR2(cerebellar degeneration-related protein 2, 62kDa) The peptide sequence was selected from the N terminal of CDR2. Peptide sequence MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQ.
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
IgG purified


Application Notes
This is a rabbit polyclonal antibody against CDR2 and was validated on Western Blot and immunohistochemistry-P

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
52 kDa


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.


cdr2 normally sequesters c-Myc in the neuronal cytoplasm, thereby down-regulating c-Myc activity, and suggest a mechanism whereby inhibition of cdr2 function by autoantibodies in PCD may contribute to Purkinje neuronal.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, Flow, FLISA, ICC/IF, IP, PAGE
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, B/N, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-IC
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, InhibTFunc
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for CDR2 Antibody (NBP1-54831) (0)

There are no publications for CDR2 Antibody (NBP1-54831).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDR2 Antibody (NBP1-54831) (0)

There are no reviews for CDR2 Antibody (NBP1-54831). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for CDR2 Antibody (NBP1-54831). (Showing 1 - 1 of 1 FAQ).

  1. I'm looking for an antibody against human CDR2 to recognize thymic epithelial cells. You have several anti CDR2 antibodies. Are they against a thymic epithelial antigen or against the cerebellar degeneration-related protein 2, 62kDa?
    • Yes, the specific antibody you have inquired about is against cerebellar degeneration-related protein 2, 62 kDa. Moreover, all of our CDR2 primaries are against the same target.

Additional CDR2 Antibody Products

Related Products by Gene

Bioinformatics Tool for CDR2 Antibody (NBP1-54831)

Discover related pathways, diseases and genes to CDR2 Antibody (NBP1-54831). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDR2 Antibody (NBP1-54831)

Discover more about diseases related to CDR2 Antibody (NBP1-54831).

Pathways for CDR2 Antibody (NBP1-54831)

View related products by pathway.

PTMs for CDR2 Antibody (NBP1-54831)

Learn more about PTMs related to CDR2 Antibody (NBP1-54831).

Blogs on CDR2.

Cerebellar Degeneration-Related Protein 2 (CDR2): Cell-Cycle Regulated Tumor Antigen
CDR2 is a tumor antigen expressed in a high percentage of breast and ovarian tumors and is the target of a naturally occurring tumor immune response in patients with paraneoplastic cerebellar degeneration. CDR2 has also been shown to be a cell cycle r...  Read full blog post.

Contact Information

Product PDFs


Gene Symbol CDR2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-54831 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.