CDR2 Antibody


Western Blot: CDR2 Antibody [NBP1-54831] - HepG2 tissue lysate at a concentration of 5ug/ml.
Immunohistochemistry-Paraffin: CDR2 Antibody [NBP1-54831] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.

Product Details

Product Discontinued
View other related CDR2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CDR2 Antibody Summary

Synthetic peptides corresponding to CDR2(cerebellar degeneration-related protein 2, 62kDa) The peptide sequence was selected from the N terminal of CDR2. Peptide sequence MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQ.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against CDR2 and was validated on Western Blot and immunohistochemistry-P
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CDR2 Antibody

  • CDR62
  • cerebellar degeneration-related protein (62kD)
  • cerebellar degeneration-related protein 2
  • cerebellar degeneration-related protein 2, 62kDa
  • Major Yo paraneoplastic antigen
  • Paraneoplastic cerebellar degeneration-associated antigen
  • PCD17
  • Yo paraneoplastic antigen
  • Yo


cdr2 normally sequesters c-Myc in the neuronal cytoplasm, thereby down-regulating c-Myc activity, and suggest a mechanism whereby inhibition of cdr2 function by autoantibodies in PCD may contribute to Purkinje neuronal.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu, Mu, Rt
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CDR2 Antibody (NBP1-54831) (0)

There are no publications for CDR2 Antibody (NBP1-54831).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDR2 Antibody (NBP1-54831) (0)

There are no reviews for CDR2 Antibody (NBP1-54831). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDR2 Antibody (NBP1-54831). (Showing 1 - 1 of 1 FAQ).

  1. I'm looking for an antibody against human CDR2 to recognize thymic epithelial cells. You have several anti CDR2 antibodies. Are they against a thymic epithelial antigen or against the cerebellar degeneration-related protein 2, 62kDa?
    • Yes, the specific antibody you have inquired about is against cerebellar degeneration-related protein 2, 62 kDa. Moreover, all of our CDR2 primaries are against the same target.

Secondary Antibodies


Isotype Controls

Additional CDR2 Products

Bioinformatics Tool for CDR2 Antibody (NBP1-54831)

Discover related pathways, diseases and genes to CDR2 Antibody (NBP1-54831). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDR2 Antibody (NBP1-54831)

Discover more about diseases related to CDR2 Antibody (NBP1-54831).

Pathways for CDR2 Antibody (NBP1-54831)

View related products by pathway.

PTMs for CDR2 Antibody (NBP1-54831)

Learn more about PTMs related to CDR2 Antibody (NBP1-54831).

Research Areas for CDR2 Antibody (NBP1-54831)

Find related products by research area.

Blogs on CDR2.

Cerebellar Degeneration-Related Protein 2 (CDR2): Cell-Cycle Regulated Tumor Antigen
CDR2 is a tumor antigen expressed in a high percentage of breast and ovarian tumors and is the target of a naturally occurring tumor immune response in patients with paraneoplastic cerebellar degeneration. CDR2 has also been shown to be a cell cycle r...  Read full blog post.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CDR2 Antibody and receive a gift card or discount.


Gene Symbol CDR2