CDR2 Antibody (4D2)

Images

 
Western Blot: CDR2 Antibody (4D2) [H00001039-M03] - Analysis of CDR2 expression in transfected 293T cell line by CDR2 monoclonal antibody (M03), clone 4D2. Lane 1: CDR2 transfected lysate (Predicted MW: 51.9 KDa). Lane ...read more
Immunocytochemistry/ Immunofluorescence: CDR2 Antibody (4D2) [H00001039-M03] - Analysis of monoclonal antibody to CDR2 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: CDR2 Antibody (4D2) [H00001039-M03] - Detection limit for recombinant GST tagged CDR2 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CDR2 Antibody (4D2) Summary

Immunogen
CDR2 (AAH17503, 1 a.a. - 454 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS
Specificity
Reacts with cerebellar degeneration-related protein 2, 62kDa.
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDR2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDR2 Antibody (4D2)

  • CDR62
  • cerebellar degeneration-related protein (62kD)
  • cerebellar degeneration-related protein 2
  • cerebellar degeneration-related protein 2, 62kDa
  • Major Yo paraneoplastic antigen
  • Paraneoplastic cerebellar degeneration-associated antigen
  • PCD17
  • Yo paraneoplastic antigen
  • Yo

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57758
Species: Hu
Applications: ICC/IF
NBP2-02023
Species: Hu
Applications: WB, ICC/IF
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-46466
Species: Hu
Applications: IHC
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-45883
Species: Hu, Mu, Rt
Applications: WB, IHC, IP
NBP1-84297
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33506
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00001039-M03
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for CDR2 Antibody (H00001039-M03) (0)

There are no publications for CDR2 Antibody (H00001039-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDR2 Antibody (H00001039-M03) (0)

There are no reviews for CDR2 Antibody (H00001039-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CDR2 Antibody (H00001039-M03). (Showing 1 - 1 of 1 FAQ).

  1. I'm looking for an antibody against human CDR2 to recognize thymic epithelial cells. You have several anti CDR2 antibodies. Are they against a thymic epithelial antigen or against the cerebellar degeneration-related protein 2, 62kDa?
    • Yes, the specific antibody you have inquired about is against cerebellar degeneration-related protein 2, 62 kDa. Moreover, all of our CDR2 primaries are against the same target.

Secondary Antibodies

 

Isotype Controls

Additional CDR2 Products

Bioinformatics Tool for CDR2 Antibody (H00001039-M03)

Discover related pathways, diseases and genes to CDR2 Antibody (H00001039-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDR2 Antibody (H00001039-M03)

Discover more about diseases related to CDR2 Antibody (H00001039-M03).
 

Pathways for CDR2 Antibody (H00001039-M03)

View related products by pathway.

PTMs for CDR2 Antibody (H00001039-M03)

Learn more about PTMs related to CDR2 Antibody (H00001039-M03).
 

Research Areas for CDR2 Antibody (H00001039-M03)

Find related products by research area.

Blogs on CDR2.

Cerebellar Degeneration-Related Protein 2 (CDR2): Cell-Cycle Regulated Tumor Antigen
CDR2 is a tumor antigen expressed in a high percentage of breast and ovarian tumors and is the target of a naturally occurring tumor immune response in patients with paraneoplastic cerebellar degeneration. CDR2 has also been shown to be a cell cycle r...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDR2 Antibody (4D2) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDR2
Entrez
Uniprot