CDP/CUTL1 Antibody (2A10) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related CDP/CUTL1 Primary Antibodies

Order Details


    • Catalog Number
      H00001523-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CDP/CUTL1 Antibody (2A10) [PE] Summary

Immunogen
CUTL1 (NP_001904.2, 521 a.a. - 620 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI
Specificity
CUTL1 - cut-like 1, CCAAT displacement protein (Drosophila)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CUX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation

Reactivity Notes

Mouse reactivity reported from customer review. Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDP/CUTL1 Antibody (2A10) [PE]

  • CASP
  • CCAAT displacement protein
  • CDP
  • CDP/Cux
  • CDPCCAAT displacement protein
  • COY1
  • cut (Drosophila)-like 1 (CCAAT displacement protein)
  • CUT
  • CUTL1
  • cut-like 1, CCAAT displacement protein (Drosophila)
  • cut-like homeobox 1
  • CUX
  • CUX1
  • FLJ31745
  • golgi integral membrane protein 6
  • GOLIM6
  • homeobox protein cut-like 1
  • Homeobox protein cux-1
  • Nbla10317
  • p100
  • p110
  • p200
  • p75
  • protein CASP
  • putative protein product of Nbla10317

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
MAB6638
Species: Hu, Mu, Rt
Applications: WB
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-87801
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NB110-40561
Species: Hu
Applications: WB, IP
H00001523-M01PE
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for CDP/CUTL1 Antibody (H00001523-M01PE) (0)

There are no publications for CDP/CUTL1 Antibody (H00001523-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDP/CUTL1 Antibody (H00001523-M01PE) (0)

There are no reviews for CDP/CUTL1 Antibody (H00001523-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CDP/CUTL1 Antibody (H00001523-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDP/CUTL1 Products

Bioinformatics Tool for CDP/CUTL1 Antibody (H00001523-M01PE)

Discover related pathways, diseases and genes to CDP/CUTL1 Antibody (H00001523-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDP/CUTL1 Antibody (H00001523-M01PE)

Discover more about diseases related to CDP/CUTL1 Antibody (H00001523-M01PE).
 

Pathways for CDP/CUTL1 Antibody (H00001523-M01PE)

View related products by pathway.

PTMs for CDP/CUTL1 Antibody (H00001523-M01PE)

Learn more about PTMs related to CDP/CUTL1 Antibody (H00001523-M01PE).

Blogs on CDP/CUTL1

There are no specific blogs for CDP/CUTL1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDP/CUTL1 Antibody (2A10) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol CUX1
Entrez