Cdk6 Antibody (8H4) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related Cdk6 Primary Antibodies

Order Details


    • Catalog Number
      H00001021-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Cdk6 Antibody (8H4) [DyLight 488] Summary

Immunogen
CDK6 (NP_001250 3 a.a. - 99 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFE
Specificity
CDK6 - cyclin-dependent kinase 6
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDK6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Proximity Ligation Assay

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cdk6 Antibody (8H4) [DyLight 488]

  • Cell division protein kinase 6
  • cyclin-dependent kinase 6
  • EC 2.7.11
  • EC 2.7.11.22
  • PLSTIREMGC59692
  • Serine/threonine-protein kinase PLSTIRE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
AF1555
Species: Hu
Applications: WB
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP1-31806
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
H00001021-M01G
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA

Publications for Cdk6 Antibody (H00001021-M01G) (0)

There are no publications for Cdk6 Antibody (H00001021-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cdk6 Antibody (H00001021-M01G) (0)

There are no reviews for Cdk6 Antibody (H00001021-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cdk6 Antibody (H00001021-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cdk6 Products

Bioinformatics Tool for Cdk6 Antibody (H00001021-M01G)

Discover related pathways, diseases and genes to Cdk6 Antibody (H00001021-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cdk6 Antibody (H00001021-M01G)

Discover more about diseases related to Cdk6 Antibody (H00001021-M01G).
 

Pathways for Cdk6 Antibody (H00001021-M01G)

View related products by pathway.

PTMs for Cdk6 Antibody (H00001021-M01G)

Learn more about PTMs related to Cdk6 Antibody (H00001021-M01G).
 

Research Areas for Cdk6 Antibody (H00001021-M01G)

Find related products by research area.

Blogs on Cdk6

There are no specific blogs for Cdk6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cdk6 Antibody (8H4) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK6