CDK5 Activator 1 Antibody (4G11) [DyLight 680]

Images

 

Product Details

Summary
Product Discontinued
View other related CDK5 Activator 1 Primary Antibodies

Order Details


    • Catalog Number
      H00008851-M01FR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CDK5 Activator 1 Antibody (4G11) [DyLight 680] Summary

Immunogen
CDK5R1 (AAH20580, 208 a.a. - 307 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR
Specificity
CDK5R1 - cyclin-dependent kinase 5, regulatory subunit 1 (p35)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDK5R1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDK5 Activator 1 Antibody (4G11) [DyLight 680]

  • CDK5 Activator 1
  • CDK5P35
  • CDK5R
  • CDK5R1
  • cyclin-dependent kinase 5 activator 1
  • Cyclin-dependent kinase 5 regulatory subunit 1
  • cyclin-dependent kinase 5, regulatory subunit 1 (p35)
  • MGC33831
  • NCK5A
  • Neuronal CDK5 Activator
  • p23
  • p25
  • p35
  • p35nck5a
  • regulatory partner for CDK5 kinase
  • tau protein kinase II 23kDa subunit
  • TPKII Regulatory Subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
409-ML/CF
Species: Mu
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00008941-P01
Species: Hu
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00008851-M01FR
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for CDK5 Activator 1 Antibody (H00008851-M01FR) (0)

There are no publications for CDK5 Activator 1 Antibody (H00008851-M01FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDK5 Activator 1 Antibody (H00008851-M01FR) (0)

There are no reviews for CDK5 Activator 1 Antibody (H00008851-M01FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CDK5 Activator 1 Antibody (H00008851-M01FR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDK5 Activator 1 Products

Bioinformatics Tool for CDK5 Activator 1 Antibody (H00008851-M01FR)

Discover related pathways, diseases and genes to CDK5 Activator 1 Antibody (H00008851-M01FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDK5 Activator 1 Antibody (H00008851-M01FR)

Discover more about diseases related to CDK5 Activator 1 Antibody (H00008851-M01FR).
 

Pathways for CDK5 Activator 1 Antibody (H00008851-M01FR)

View related products by pathway.

PTMs for CDK5 Activator 1 Antibody (H00008851-M01FR)

Learn more about PTMs related to CDK5 Activator 1 Antibody (H00008851-M01FR).
 

Research Areas for CDK5 Activator 1 Antibody (H00008851-M01FR)

Find related products by research area.

Blogs on CDK5 Activator 1

There are no specific blogs for CDK5 Activator 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDK5 Activator 1 Antibody (4G11) [DyLight 680] and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK5R1
Entrez