CDK4 Antibody (1E1.)

Images

 
Western Blot: CDK4 Antibody (1E1) [H00001019-M10] - Analysis of CDK4 expression in transfected 293T cell line by CDK4 monoclonal antibody (M10), clone 1E1. Lane 1: CDK4 transfected lysatE (33.7 KDa). Lane 2: ...read more
Sandwich ELISA: CDK4 Antibody (1E1) [H00001019-M10] - Detection limit for recombinant GST tagged CDK4 is 3 ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related CDK4 Primary Antibodies

Order Details


    • Catalog Number
      H00001019-M10
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CDK4 Antibody (1E1.) Summary

Immunogen
CDK4 (AAH03644, 1 a.a. - 303 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Specificity
CDK4 - cyclin-dependent kinase 4 (1E1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDK4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDK4 Antibody (1E1.)

  • CDK4
  • Cell division protein kinase 4
  • CMM3
  • cyclin-dependent kinase 4
  • EC 2.7.11
  • EC 2.7.11.22
  • melanoma cutaneous malignant, 3
  • MGC14458
  • PSK-J3
  • PSK-J3cell division kinase 4

Background

The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene products of S. cerevisiae cdc28 and S. pombe cdc2. It is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression. The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D-type cyclins and CDK inhibitor p16(INK4a). This kinase was shown to be responsible for the phosphorylation of retinoblastoma gene product (Rb). Mutations in this gene as well as in its related proteins including D-type cyclins, p16(INK4a) and Rb were all found to be associated with tumorigenesis of a variety of cancers. Multiple polyadenylation sites of this gene have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-87262
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
AF1555
Species: Hu
Applications: WB
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-31806
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CDK4 Antibody (H00001019-M10) (0)

There are no publications for CDK4 Antibody (H00001019-M10).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDK4 Antibody (H00001019-M10) (0)

There are no reviews for CDK4 Antibody (H00001019-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDK4 Antibody (H00001019-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDK4 Products

Bioinformatics Tool for CDK4 Antibody (H00001019-M10)

Discover related pathways, diseases and genes to CDK4 Antibody (H00001019-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDK4 Antibody (H00001019-M10)

Discover more about diseases related to CDK4 Antibody (H00001019-M10).
 

Pathways for CDK4 Antibody (H00001019-M10)

View related products by pathway.

PTMs for CDK4 Antibody (H00001019-M10)

Learn more about PTMs related to CDK4 Antibody (H00001019-M10).
 

Research Areas for CDK4 Antibody (H00001019-M10)

Find related products by research area.

Blogs on CDK4

There are no specific blogs for CDK4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDK4 Antibody (1E1.) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK4
Entrez
Uniprot