CDK2 Antibody (2E8)

Western Blot: CDK2 Antibody (2E8) [H00001017-M02] - Analysis of CDK2 expression in transfected 293T cell line by CDK2 monoclonal antibody (M02), clone 2E8.Lane 1: CDK2 transfected lysate(33.9 KDa).Lane 2: Non-transfected lysate.

Western Blot: CDK2 Antibody (2E8) [H00001017-M02] - Analysis of CDK2 over-expressed 293 cell line, cotransfected with CDK2 Validated Chimera RNAi ( Cat # H00001017-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CDK2 monoclonal antibody (M02) clone 2E8 (Cat # H00001017-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: CDK2 Antibody (2E8) [H00001017-M02] - CDK2 monoclonal antibody (M02), clone 2E8 Analysis of CDK2 expression in HL-60.

Western Blot: CDK2 Antibody (2E8) [H00001017-M02] - CDK2 monoclonal antibody (M02), clone 2E8. Analysis of CDK2 expression in Jurkat.

ELISA: CDK2 Antibody (2E8) [H00001017-M02] - CDK2 Antibody (2E8) [H00001017-M02] - Detection limit for recombinant GST tagged CDK2 is approximately 0.03ng/ml as a capture antibody.

Product Discontinued

CDK2 Antibody (2E8) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CDK2 (AAH03065, 211 a.a. ~ 298 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
• Localization: Cytoplasmic and Nuclear
• Specificity: CDK2 - cyclin-dependent kinase 2
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CDK2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Knockdown Validated
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDK2 Antibody (2E8)

• cdc2-related protein kinase
• CDK2
• cell devision kinase 2
• Cell division protein kinase 2
• cyclin-dependent kinase 2
• EC 2.7.11
• EC 2.7.11.22
• p33 protein kinase
• p33(CDK2)

Background

The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein kinase is highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2. It is a catalytic subunit of the cyclin-dependent protein kinase complex, whose activity is restricted to the G1-S phase, and essential for cell cycle G1/S phase transition. This protein associates with and regulated by the regulatory subunits of the complex including cyclin A or E, CDK inhibitor p21Cip1 (CDKN1A) and p27Kip1 (CDKN1B). Its activity is also regulated by its protein phosphorylation. Two alternatively spliced variants and multiple transcription initiation sites of this gene have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDK2
• Entrez:
  • 1017(Human)
• OMIM:
  • 116953(Human)
• Uniprot:
  • AAH03065(Human)