Recombinant Human CDC42EP3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CDC42EP3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 42-108 of Human CDC42EP3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:IHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAIS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CDC42EP3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CDC42EP3 Protein

  • Binder of Rho GTPases 2
  • BORG2CEP3UB1
  • CDC42 effector protein (Rho GTPase binding) 3
  • cdc42 effector protein 3
  • CRIB-containing BORG2 protein
  • FLJ46903
  • MSE55-related Cdc42-binding protein
  • MSE55-related protein

Background

CDC42EP3 - CDC42 effector protein (Rho GTPase binding) 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88379
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88380
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4079
Species: Hu
Applications: WB, ICC
NBP1-88383
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-91773
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-55474
Species: Hu
Applications: ICC/IF
MAB2014
Species: Hu
Applications: Flow, CyTOF-reported
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP2-48704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58498
Species: Hu
Applications: ICC/IF
NBP1-47542
Species: Hu, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-87132
Species: Hu
Applications: WB, IHC, IHC-P
AF284
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
NBP1-48308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-45514
Species: Hu
Applications: WB, IHC
H00010602-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for CDC42EP3 Partial Recombinant Protein (H00010602-Q01) (0)

There are no publications for CDC42EP3 Partial Recombinant Protein (H00010602-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC42EP3 Partial Recombinant Protein (H00010602-Q01) (0)

There are no reviews for CDC42EP3 Partial Recombinant Protein (H00010602-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDC42EP3 Partial Recombinant Protein (H00010602-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDC42EP3 Products

Bioinformatics Tool for CDC42EP3 Partial Recombinant Protein (H00010602-Q01)

Discover related pathways, diseases and genes to CDC42EP3 Partial Recombinant Protein (H00010602-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC42EP3 Partial Recombinant Protein (H00010602-Q01)

Discover more about diseases related to CDC42EP3 Partial Recombinant Protein (H00010602-Q01).
 

Pathways for CDC42EP3 Partial Recombinant Protein (H00010602-Q01)

View related products by pathway.

PTMs for CDC42EP3 Partial Recombinant Protein (H00010602-Q01)

Learn more about PTMs related to CDC42EP3 Partial Recombinant Protein (H00010602-Q01).

Blogs on CDC42EP3

There are no specific blogs for CDC42EP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CDC42EP3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC42EP3