Recombinant Human CDC42 Protein

Product Discontinued

Recombinant Human CDC42 Protein Summary

• Description: A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1-95 of Human CDC42 partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:KEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC

• Protein/Peptide Type: Partial Recombinant Protein
• Gene: CDC42

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CDC42 Protein

• CDC42
• CDC42Hs
• cell division control protein 42 homolog
• cell division cycle 42 (GTP binding protein, 25kDa)
• cell division cycle 42 (GTP-binding protein, 25kD)
• dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein, 25kD))
• dJ224A6.1.2 (cell division cycle 42 (GTP-binding protein, 25kD))
• G25K GTP-binding protein
• G25K
• growth-regulating protein
• GTP-binding protein, 25kD
• small GTP binding protein CDC42

Background

CDC42 - cell division cycle 42 (GTP binding protein, 25kDa)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDC42