Cdc27 Antibody

Images

 
Western Blot: Cdc27 Antibody [NBP1-55513] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related Cdc27 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-55513
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Cdc27 Antibody Summary

Immunogen
Synthetic peptides corresponding to CDC27(cell division cycle 27 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of CDC27. Peptide sequence KLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKIST.
Clonality
Polyclonal
Host
Rabbit
Gene
CDC27
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CDC27 and was validated on Western blot.
Theoretical MW
92 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cdc27 Antibody

  • ANAPC3CDC27 homolog
  • anaphase promoting complex subunit 3
  • Anaphase-promoting complex subunit 3
  • anaphase-promoting complex, protein 3
  • APC 3
  • APC3cell division cycle 27
  • CDC27Hs
  • cell division cycle 27 homolog (S. cerevisiae)
  • cell division cycle protein 27 homolog
  • D0S1430E
  • D17S978E
  • HNUC
  • H-NUC
  • nuc2 homolog
  • NUC2

Background

The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae protein Cdc27, and the gene product of Schizosaccharomyces pombe nuc 2. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction. This protein was shown to interact with mitotic checkpoint proteins including Mad2, p55CDC and BUBR1, and thus may be involved in controlling the timing of mitosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP1-77155
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-77157
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF4497
Species: Hu
Applications: WB, Simple Western
NBP2-20389
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77376
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-01128
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-55513
Species: Hu
Applications: WB

Publications for Cdc27 Antibody (NBP1-55513) (0)

There are no publications for Cdc27 Antibody (NBP1-55513).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cdc27 Antibody (NBP1-55513) (0)

There are no reviews for Cdc27 Antibody (NBP1-55513). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cdc27 Antibody (NBP1-55513) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cdc27 Products

Bioinformatics Tool for Cdc27 Antibody (NBP1-55513)

Discover related pathways, diseases and genes to Cdc27 Antibody (NBP1-55513). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cdc27 Antibody (NBP1-55513)

Discover more about diseases related to Cdc27 Antibody (NBP1-55513).
 

Pathways for Cdc27 Antibody (NBP1-55513)

View related products by pathway.

PTMs for Cdc27 Antibody (NBP1-55513)

Learn more about PTMs related to Cdc27 Antibody (NBP1-55513).
 

Research Areas for Cdc27 Antibody (NBP1-55513)

Find related products by research area.

Blogs on Cdc27

There are no specific blogs for Cdc27, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cdc27 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC27
Uniprot