Recombinant Human CDC16 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CDC16 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 191-290 of Human CDC16 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CDC16

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CDC16 Protein

  • ANAPC6subunit 6
  • CDC16 (cell division cycle 16, S. cerevisiae, homolog)
  • CDC16 cell division cycle 16 homolog (S. cerevisiae)
  • CDC16 homolog
  • CDC16Hs
  • cell division cycle 16 homolog (S. cerevisiae)
  • cell division cycle protein 16 homolog
  • Cyclosome subunit 6

Background

CDC16 - CDC16 cell division cycle 16 homolog (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89095
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009098-M01
Species: Hu
Applications: WB, ELISA
NBP1-89093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54654
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NB120-10535
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-00597
Species: Hu, Mk
Applications: WB, Flow, ICC/IF
NBP1-77375
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-57669
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-36551
Species: Hu, Mu
Applications: WB, IP
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-91771
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77157
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready

Publications for CDC16 Partial Recombinant Protein (H00008881-Q01) (0)

There are no publications for CDC16 Partial Recombinant Protein (H00008881-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC16 Partial Recombinant Protein (H00008881-Q01) (0)

There are no reviews for CDC16 Partial Recombinant Protein (H00008881-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDC16 Partial Recombinant Protein (H00008881-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDC16 Products

Bioinformatics Tool for CDC16 Partial Recombinant Protein (H00008881-Q01)

Discover related pathways, diseases and genes to CDC16 Partial Recombinant Protein (H00008881-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC16 Partial Recombinant Protein (H00008881-Q01)

Discover more about diseases related to CDC16 Partial Recombinant Protein (H00008881-Q01).
 

Pathways for CDC16 Partial Recombinant Protein (H00008881-Q01)

View related products by pathway.

PTMs for CDC16 Partial Recombinant Protein (H00008881-Q01)

Learn more about PTMs related to CDC16 Partial Recombinant Protein (H00008881-Q01).
 

Research Areas for CDC16 Partial Recombinant Protein (H00008881-Q01)

Find related products by research area.

Blogs on CDC16

There are no specific blogs for CDC16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

APC Antibody
NB100-91662
CDC16 Antibody
NBP1-77155
TPR Antibody
NB100-2866

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CDC16 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC16