Recombinant Human Cdc14B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Cdc14B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-471 of Human CDC14B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTDGWLSQAVTFLDRLLIWLGIHKD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CDC14B
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cdc14B Protein

  • CDC14 cell division cycle 14 homolog B (S. cerevisiae)
  • CDC14 cell division cycle 14 homolog B
  • S. cerevisiae) homolog B

Background

The protein encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. This protein is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, which suggests the role in cell cycle control. This protein has been shown to interact with and dephosphorylates tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splice of this gene results in 3 transcript variants encoding distinct isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4457
Species: Hu, Mu, Rt
Applications: WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
AF1555
Species: Hu
Applications: WB
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
AF6817
Species: Hu
Applications: WB
H00008555-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Cdc14B Recombinant Protein (H00008555-P01) (0)

There are no publications for Cdc14B Recombinant Protein (H00008555-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cdc14B Recombinant Protein (H00008555-P01) (0)

There are no reviews for Cdc14B Recombinant Protein (H00008555-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cdc14B Recombinant Protein (H00008555-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cdc14B Products

Bioinformatics Tool for Cdc14B Recombinant Protein (H00008555-P01)

Discover related pathways, diseases and genes to Cdc14B Recombinant Protein (H00008555-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cdc14B Recombinant Protein (H00008555-P01)

Discover more about diseases related to Cdc14B Recombinant Protein (H00008555-P01).
 

Pathways for Cdc14B Recombinant Protein (H00008555-P01)

View related products by pathway.

PTMs for Cdc14B Recombinant Protein (H00008555-P01)

Learn more about PTMs related to Cdc14B Recombinant Protein (H00008555-P01).
 

Research Areas for Cdc14B Recombinant Protein (H00008555-P01)

Find related products by research area.

Blogs on Cdc14B

There are no specific blogs for Cdc14B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Cdc14B Antibody
H00008555-B01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cdc14B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC14B