CD99 Antibody (3A10)

Images

 
Western Blot: CD99 Antibody (3A10) [H00004267-M01] - CD99 monoclonal antibody (M01), clone 3A10 Analysis of CD99 expression in K-562.
Western Blot: CD99 Antibody (3A10) [H00004267-M01] - Analysis of CD99 expression in transfected 293T cell line by CD99 monoclonal antibody (M01), clone 3A10.Lane 1: CD99 transfected lysate(18.8 KDa).Lane 2: ...read more
Sandwich ELISA: CD99 Antibody (3A10) [H00004267-M01] - Detection limit for recombinant GST tagged CD99 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CD99 Antibody (3A10) Summary

Immunogen
CD99 (AAH03147, 23 a.a. - 122 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEAD
Specificity
CD99 - CD99 antigen
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CD99
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00004267-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD99 Antibody (3A10)

  • 12E7
  • antigen identified by monoclonal antibodies 12E7, F21 and O13
  • CD99 antigenY homolog
  • CD99 molecule
  • CD99
  • E2 antigen
  • HBA71
  • MIC2 (monoclonal 12E7)
  • MIC2
  • MIC2Y
  • MSK5X
  • pilr-1
  • PILR-L
  • Protein MIC2
  • surface antigen MIC2
  • T-cell surface glycoprotein E2

Background

The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. Cyclophilin A binds to CD99 and may act as a signaling regulator of CD99. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB200-182
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-84856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-31368
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CD99 Antibody (H00004267-M01)(1)

Reviews for CD99 Antibody (H00004267-M01) (0)

There are no reviews for CD99 Antibody (H00004267-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD99 Antibody (H00004267-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD99 Products

Bioinformatics Tool for CD99 Antibody (H00004267-M01)

Discover related pathways, diseases and genes to CD99 Antibody (H00004267-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD99 Antibody (H00004267-M01)

Discover more about diseases related to CD99 Antibody (H00004267-M01).
 

Pathways for CD99 Antibody (H00004267-M01)

View related products by pathway.

PTMs for CD99 Antibody (H00004267-M01)

Learn more about PTMs related to CD99 Antibody (H00004267-M01).
 

Research Areas for CD99 Antibody (H00004267-M01)

Find related products by research area.

Blogs on CD99

There are no specific blogs for CD99, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD99 Antibody (3A10) and receive a gift card or discount.

Bioinformatics

Gene Symbol CD99
Entrez
OMIM
Uniprot