CD90/Thy1 Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

CD90/Thy1 Recombinant Protein Summary

Description
CD90/Thy1 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Preparation
Method
in vitro wheat germ expression system
Gene
THY1

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00007070-P01.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD90/Thy1 Recombinant Protein

  • CD90 antigen
  • CD90
  • CDw90
  • FLJ33325
  • Thy-1 antigen
  • Thy-1 cell surface antigen
  • thy-1 membrane glycoprotein
  • Thy-1 T-cell antigen
  • Thy1

Background

THY1( AAH05175, 21 a.a. - 162 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1071
Species: Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo
MAB6127
Species: Hu, Mu
Applications: Flow, CyTOF-reported
AF2405
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-92290
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
AF3628
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
NB120-16518
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
AF2335
Species: Mu
Applications: WB, Flow, IP, CyTOF-ready, ICC

Publications for CD90/Thy1 Recombinant Protein (H00007070-P01)(1)

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
All Species

Reviews for CD90/Thy1 Recombinant Protein (H00007070-P01) (0)

There are no reviews for CD90/Thy1 Recombinant Protein (H00007070-P01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD90/Thy1 Recombinant Protein (H00007070-P01). (Showing 1 - 1 of 1 FAQ).

  1. We are interested in CD90 antibodies that could react with dog, please let me know which products in your catalog you would recommend.
    • I would recommend one of theses <a href="http://www.novusbio.com/productsearch/CD90%252FThy1#fq=common_name%3A%22CD90%2FThy1%22&fq=species%3A%22Canine%22" target="_self">CD90 antibodies</a>, as these have all been validated for use with dog/canine samples.

Additional CD90/Thy1 Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for CD90/Thy1 Recombinant Protein (H00007070-P01)

Discover related pathways, diseases and genes to CD90/Thy1 Recombinant Protein (H00007070-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD90/Thy1 Recombinant Protein (H00007070-P01)

Discover more about diseases related to CD90/Thy1 Recombinant Protein (H00007070-P01).
 

Pathways for CD90/Thy1 Recombinant Protein (H00007070-P01)

View related products by pathway.

PTMs for CD90/Thy1 Recombinant Protein (H00007070-P01)

Learn more about PTMs related to CD90/Thy1 Recombinant Protein (H00007070-P01).
 

Research Areas for CD90/Thy1 Recombinant Protein (H00007070-P01)

Find related products by research area.

Blogs on CD90/Thy1.

CD90 (Cluster of differentiation 90)
CD90 is a 25-35kD glycosylphosphatidylinositol (GPI)-linked glycoprotein receptor of the immunoglobulin (Ig) superfamily. It is found on murine T-cells, thymocytes, neuronal cells, granulocytic lineage-derived cells, hematopoietic stem cells, fibrobla...  Read full blog post.

How New Oval Stem Cell Marker Antibodies Will Benefit Hepatic Research
A large number of antibody suppliers supply conjugated and non-conjugated marker antibodies, targeted at specific stem cell populations. Until recently the number of oval stem cell markers was extremely limited. However, we at Novus Biologicals have s...  Read full blog post.

Contact Information

Product PDFs

Review this Product

Be the first to review our CD90/Thy1 Recombinant Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol THY1
Entrez

Customers Who Bought This Also Bought