Recombinant Human CD90/Thy1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CD90/Thy1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 26-134 of Human THY1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGIS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
THY1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00007070-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD90/Thy1 Protein

  • CD90 antigen
  • CD90
  • CDw90
  • FLJ33325
  • Thy-1 antigen
  • Thy-1 cell surface antigen
  • thy-1 membrane glycoprotein
  • Thy-1 T-cell antigen
  • Thy1

Background

THY1 - Thy-1 cell surface antigen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
AF1172
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
NB120-16518
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for CD90/Thy1 Partial Recombinant Protein (H00007070-Q01)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CD90/Thy1 Partial Recombinant Protein (H00007070-Q01) (0)

There are no reviews for CD90/Thy1 Partial Recombinant Protein (H00007070-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD90/Thy1 Partial Recombinant Protein (H00007070-Q01). (Showing 1 - 1 of 1 FAQ).

  1. We are interested in CD90 antibodies that could react with dog, please let me know which products in your catalog you would recommend.
    • I would recommend one of theses <a href="http://www.novusbio.com/productsearch/CD90%252FThy1#fq=common_name%3A%22CD90%2FThy1%22&fq=species%3A%22Canine%22" target="_self">CD90 antibodies</a>, as these have all been validated for use with dog/canine samples.

Additional CD90/Thy1 Products

Bioinformatics Tool for CD90/Thy1 Partial Recombinant Protein (H00007070-Q01)

Discover related pathways, diseases and genes to CD90/Thy1 Partial Recombinant Protein (H00007070-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD90/Thy1 Partial Recombinant Protein (H00007070-Q01)

Discover more about diseases related to CD90/Thy1 Partial Recombinant Protein (H00007070-Q01).
 

Pathways for CD90/Thy1 Partial Recombinant Protein (H00007070-Q01)

View related products by pathway.

PTMs for CD90/Thy1 Partial Recombinant Protein (H00007070-Q01)

Learn more about PTMs related to CD90/Thy1 Partial Recombinant Protein (H00007070-Q01).
 

Research Areas for CD90/Thy1 Partial Recombinant Protein (H00007070-Q01)

Find related products by research area.

Blogs on CD90/Thy1.

CD90 (Cluster of differentiation 90)
CD90 is a 25-35kD glycosylphosphatidylinositol (GPI)-linked glycoprotein receptor of the immunoglobulin (Ig) superfamily. It is found on murine T-cells, thymocytes, neuronal cells, granulocytic lineage-derived cells, hematopoietic stem cells, fibrobla...  Read full blog post.

How New Oval Stem Cell Marker Antibodies Will Benefit Hepatic Research
A large number of antibody suppliers supply conjugated and non-conjugated marker antibodies, targeted at specific stem cell populations. Until recently the number of oval stem cell markers was extremely limited. However, we at Novus Biologicals have s...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CD90/Thy1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol THY1
Entrez