CD8 beta Antibody

Images

 
Western Blot: CD8 beta Antibody [NBP1-59057] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related CD8 beta Primary Antibodies

Order Details


    • Catalog Number
      NBP1-59057
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CD8 beta Antibody Summary

Immunogen
Synthetic peptides corresponding to CD8B(CD8b molecule) The peptide sequence was selected from the middle region of CD8B. Peptide sequence KPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCR.
Clonality
Polyclonal
Host
Rabbit
Gene
CD8B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CD8B and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CD8 beta Antibody

  • CD8 antigen, beta polypeptide 1 (p37)
  • CD8 beta
  • CD8b antigen
  • CD8b molecule
  • CD8b
  • CD8B1
  • CD8B1P37
  • Leu2
  • LY3
  • LYT3
  • MGC119115
  • P37
  • T lymphocyte surface glycoprotein beta chain
  • T-cell surface glycoprotein CD8 beta chain

Background

The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigen displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. CD8B is the CD8 beta chain isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
409-ML/CF
Species: Mu
AF3848
Species: Hu
Applications: WB, IHC, IP
NB100-98844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-88915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
26660002
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-59057
Species: Hu
Applications: WB

Publications for CD8 beta Antibody (NBP1-59057) (0)

There are no publications for CD8 beta Antibody (NBP1-59057).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD8 beta Antibody (NBP1-59057) (0)

There are no reviews for CD8 beta Antibody (NBP1-59057). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD8 beta Antibody (NBP1-59057) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD8 beta Products

Bioinformatics Tool for CD8 beta Antibody (NBP1-59057)

Discover related pathways, diseases and genes to CD8 beta Antibody (NBP1-59057). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD8 beta Antibody (NBP1-59057)

Discover more about diseases related to CD8 beta Antibody (NBP1-59057).
 

Pathways for CD8 beta Antibody (NBP1-59057)

View related products by pathway.

PTMs for CD8 beta Antibody (NBP1-59057)

Learn more about PTMs related to CD8 beta Antibody (NBP1-59057).
 

Research Areas for CD8 beta Antibody (NBP1-59057)

Find related products by research area.

Blogs on CD8 beta

There are no specific blogs for CD8 beta, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD8 beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD8B
Entrez
Uniprot