CD79B Antibody

Images

 
Western Blot: CD79B Antibody [H00000974-B01P] - Analysis of CD79B expression in transfected 293T cell line by CD79B polyclonal antibody. Lane 1: CD79B transfected lysate(25.19 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CD79B Antibody Summary

Immunogen
CD79B (NP_000617.1, 1 a.a. - 229 a.a.) full-length human protein. MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Specificity
Reacts with CD79b molecule, immunoglobulin-associated beta.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CD79B
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD79B Antibody

  • B29
  • B29B-cell-specific glycoprotein B29
  • B-cell antigen receptor complex-associated protein beta chain
  • CD79B antigen (immunoglobulin-associated beta)
  • CD79b antigen
  • CD79b molecule, immunoglobulin-associated beta
  • CD79B
  • IGB
  • IGBAGM6
  • Ig-beta
  • Immunoglobulin-associated B29 protein

Background

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-64347
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq, Ft, Gt, GP, Mk, Rb
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-02690
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP2-46125
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IF
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP2-37585
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB500-519
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
AF123
Species: Hu
Applications: WB, Block, ICC
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for CD79B Antibody (H00000974-B01P) (0)

There are no publications for CD79B Antibody (H00000974-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD79B Antibody (H00000974-B01P) (0)

There are no reviews for CD79B Antibody (H00000974-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD79B Antibody (H00000974-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD79B Products

Bioinformatics Tool for CD79B Antibody (H00000974-B01P)

Discover related pathways, diseases and genes to CD79B Antibody (H00000974-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD79B Antibody (H00000974-B01P)

Discover more about diseases related to CD79B Antibody (H00000974-B01P).
 

Pathways for CD79B Antibody (H00000974-B01P)

View related products by pathway.

PTMs for CD79B Antibody (H00000974-B01P)

Learn more about PTMs related to CD79B Antibody (H00000974-B01P).

Blogs on CD79B.

CD79b - A Signal Transduction Component of the B-cell Receptor
The B-cell antigen receptor (BCR) is a complex multimeric aggregate that includes the following key noncovalently-bound components: antigen-specific surface immunoglobulin (Ig), CD79a (Ig-alpha), and CD79b (Ig-beta). BCR signaling is a pivotal pathway...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD79B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD79B
Entrez
Uniprot