CD79A Antibody

Images

 
Western Blot: CD79A Antibody [H00000973-D01P] - Analysis of CD79A expression in transfected 293T cell line by CD79A polyclonal antibody.Lane 1: CD79A transfected lysate(25.00 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD79A Antibody Summary

Immunogen
CD79A (NP_001774.1, 1 a.a. - 226 a.a.) full-length human protein. MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
Specificity
Reacts with CD79a molecule, immunoglobulin-associated alpha.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD79A
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD79A Antibody

  • CD79A antigen (immunoglobulin-associated alpha)
  • CD79a antigen
  • CD79a molecule, immunoglobulin-associated alpha
  • CD79A
  • IGAB-cell antigen receptor complex-associated protein alpha chain
  • ig-alpha
  • MB-1 membrane glycoprotein
  • MB1
  • MB-1
  • Membrane-bound immunoglobulin-associated protein
  • Surface IgM-associated protein

Background

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-28140
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IP
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-13608
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP2-46157
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-02690
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF3487
Species: Hu
Applications: WB, IHC, ICC
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
MAB2038
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46125
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IF
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for CD79A Antibody (H00000973-D01P) (0)

There are no publications for CD79A Antibody (H00000973-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD79A Antibody (H00000973-D01P) (0)

There are no reviews for CD79A Antibody (H00000973-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD79A Antibody (H00000973-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD79A Products

Bioinformatics Tool for CD79A Antibody (H00000973-D01P)

Discover related pathways, diseases and genes to CD79A Antibody (H00000973-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD79A Antibody (H00000973-D01P)

Discover more about diseases related to CD79A Antibody (H00000973-D01P).
 

Pathways for CD79A Antibody (H00000973-D01P)

View related products by pathway.

PTMs for CD79A Antibody (H00000973-D01P)

Learn more about PTMs related to CD79A Antibody (H00000973-D01P).
 

Research Areas for CD79A Antibody (H00000973-D01P)

Find related products by research area.

Blogs on CD79A.

CD79b - A Signal Transduction Component of the B-cell Receptor
The B-cell antigen receptor (BCR) is a complex multimeric aggregate that includes the following key noncovalently-bound components: antigen-specific surface immunoglobulin (Ig), CD79a (Ig-alpha), and CD79b (Ig-beta). BCR signaling is a pivotal pathway...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD79A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD79A
Entrez
Uniprot