CD7 Antibody

Images

 
Western Blot: CD7 Antibody [NBP1-69155] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Product Details

Summary
Product Discontinued
View other related CD7 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69155
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CD7 Antibody Summary

Immunogen
Synthetic peptides corresponding to CD7 (CD7 molecule) The peptide sequence was selected from the middle region of CD7. Peptide sequence SGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTIT.
Clonality
Polyclonal
Host
Rabbit
Gene
CD7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CD7 and was validated on Western blot.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CD7 Antibody

  • CD7 antigen (p41)
  • CD7 antigen
  • CD7 molecule
  • CD7
  • GP40T-cell surface antigen Leu-9
  • LEU-9
  • T-cell antigen CD7
  • T-cell leukemia antigen
  • Tp40
  • TP41
  • TP41p41 protein

Background

This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-26666
Species: Mu
Applications: B/N, Flow, IP, In vitro
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-02690
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-31368
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC

Publications for CD7 Antibody (NBP1-69155) (0)

There are no publications for CD7 Antibody (NBP1-69155).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD7 Antibody (NBP1-69155) (0)

There are no reviews for CD7 Antibody (NBP1-69155). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD7 Antibody (NBP1-69155) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD7 Products

Bioinformatics Tool for CD7 Antibody (NBP1-69155)

Discover related pathways, diseases and genes to CD7 Antibody (NBP1-69155). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD7 Antibody (NBP1-69155)

Discover more about diseases related to CD7 Antibody (NBP1-69155).
 

Pathways for CD7 Antibody (NBP1-69155)

View related products by pathway.

PTMs for CD7 Antibody (NBP1-69155)

Learn more about PTMs related to CD7 Antibody (NBP1-69155).
 

Research Areas for CD7 Antibody (NBP1-69155)

Find related products by research area.

Blogs on CD7

There are no specific blogs for CD7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD7
Entrez
Uniprot