Recombinant Human CD59 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related CD59 Peptides and Proteins

Order Details


    • Catalog Number
      H00000966-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human CD59 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-128 of Human CD59 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP

Protein/Peptide Type
Recombinant Protein
Gene
CD59

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD59 Protein

  • 16.3A5
  • 1F5 antigen
  • 1F5
  • 20 kDa homologous restriction factor
  • CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16
  • CD59 antigen
  • CD59 antigen, complement regulatory protein
  • CD59 glycoprotein
  • CD59 molecule, complement regulatory protein
  • CD59
  • EJ16
  • EJ30
  • EJ30, EL32 and G344)
  • EL32
  • FLJ38134
  • FLJ92039
  • G344
  • HRF20
  • HRF-20
  • human leukocyte antigen MIC11
  • Ly-6-like protein
  • lymphocytic antigen CD59/MEM43
  • MACIF
  • MAC-inhibitory protein
  • MAC-IP
  • MEM43 antigen
  • MEM43
  • membrane attack complex (MAC) inhibition factor
  • Membrane attack complex inhibition factor
  • Membrane inhibitor of reactive lysis
  • MGC2354
  • MIC11
  • MIC11MSK21
  • MIN1
  • MIN2
  • MIN3
  • MIRL
  • p18-20
  • Protectin
  • surface anitgen recognized by monoclonal 16.3A5
  • T cell-activating protein

Background

This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2009
Species: Hu
Applications: WB, IHC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF7177
Species: Hu
Applications: WB, ICC
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
MAB8126
Species: Hu
Applications: WB, Simple Western
MAB6529
Species: Hu
Applications: WB, Simple Western
NBL1-09016
Species: Hu
NBP2-13760
Species: Hu
Applications: IHC, IHC-P
NBP2-22542
Species: Hu
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00000966-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for CD59 Recombinant Protein (H00000966-P01) (0)

There are no publications for CD59 Recombinant Protein (H00000966-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD59 Recombinant Protein (H00000966-P01) (0)

There are no reviews for CD59 Recombinant Protein (H00000966-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD59 Recombinant Protein (H00000966-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD59 Products

Bioinformatics Tool for CD59 Recombinant Protein (H00000966-P01)

Discover related pathways, diseases and genes to CD59 Recombinant Protein (H00000966-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD59 Recombinant Protein (H00000966-P01)

Discover more about diseases related to CD59 Recombinant Protein (H00000966-P01).
 

Pathways for CD59 Recombinant Protein (H00000966-P01)

View related products by pathway.

PTMs for CD59 Recombinant Protein (H00000966-P01)

Learn more about PTMs related to CD59 Recombinant Protein (H00000966-P01).
 

Research Areas for CD59 Recombinant Protein (H00000966-P01)

Find related products by research area.

Blogs on CD59

There are no specific blogs for CD59, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CD59 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CD59
Entrez