CD48/SLAMF2 Antibody

Images

 
Western Blot: CD48/SLAMF2 Antibody [H00000962-D01P] - Analysis of CD48 expression in mouse stomach.
Western Blot: CD48/SLAMF2 Antibody [H00000962-D01P] - Analysis of CD48 expression in human kidney.
Western Blot: CD48/SLAMF2 Antibody [H00000962-D01P] - Analysis of CD48 expression in transfected 293T cell line by CD48 rabbit polyclonal antibody.Lane 1: CD48 transfected lysate(27.70 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD48/SLAMF2 Antibody Summary

Immunogen
CD48 (NP_001769.2, 1 a.a. - 243 a.a.) full-length human protein. MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGLLLT
Specificity
CD48 - CD48 molecule,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD48
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD48/SLAMF2 Antibody

  • BCM1 surface antigen
  • BCM1
  • BCM1Leukocyte antigen MEM-102
  • BLAST
  • BLAST1
  • BLAST1TCT.1
  • B-lymphocyte activation marker BLAST-1
  • CD48 antigen (B-cell membrane protein)
  • CD48 antigen
  • CD48 molecule
  • CD48
  • hCD48
  • mCD48
  • MEM-102
  • SLAMF2

Background

BLAST1 is the designation used for an activation-associated cell surface glycoprotein of 40 to 45 kD expressed primarily in mitogen-stimulated human lymphocytes. The protein sequence predicted by the cDNA encoding BLAST1 indicates that BLAST1 is a member of the immunoglobulin supergene family. Yokoyama (1991) identified the BLAST1 activation/adhesion molecule as CD48.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-26666
Species: Mu
Applications: B/N, Flow, IP, In vitro
AF1039
Species: Hu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-22542
Species: Hu
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-Fr, IP
MAB1642
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00004068-M01
Species: Hu
Applications: WB, ELISA
NB500-330
Species: Hu
Applications: B/N, Flow, IHC, IHC-P, IP, CyTOF-ready
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
MAB1855
Species: Hu
Applications: WB
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc

Publications for CD48/SLAMF2 Antibody (H00000962-D01P) (0)

There are no publications for CD48/SLAMF2 Antibody (H00000962-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD48/SLAMF2 Antibody (H00000962-D01P) (0)

There are no reviews for CD48/SLAMF2 Antibody (H00000962-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD48/SLAMF2 Antibody (H00000962-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD48/SLAMF2 Products

Bioinformatics Tool for CD48/SLAMF2 Antibody (H00000962-D01P)

Discover related pathways, diseases and genes to CD48/SLAMF2 Antibody (H00000962-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD48/SLAMF2 Antibody (H00000962-D01P)

Discover more about diseases related to CD48/SLAMF2 Antibody (H00000962-D01P).
 

Pathways for CD48/SLAMF2 Antibody (H00000962-D01P)

View related products by pathway.

PTMs for CD48/SLAMF2 Antibody (H00000962-D01P)

Learn more about PTMs related to CD48/SLAMF2 Antibody (H00000962-D01P).
 

Research Areas for CD48/SLAMF2 Antibody (H00000962-D01P)

Find related products by research area.

Blogs on CD48/SLAMF2

There are no specific blogs for CD48/SLAMF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD48/SLAMF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD48
Entrez
Uniprot