Reactivity | HuSpecies Glossary |
Applications | WB, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMT |
Specificity | Specificity of human CD45 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PTPRC |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for CD45 Antibody (NBP1-88103)Discover more about diseases related to CD45 Antibody (NBP1-88103).
| Pathways for CD45 Antibody (NBP1-88103)View related products by pathway.
|
PTMs for CD45 Antibody (NBP1-88103)Learn more about PTMs related to CD45 Antibody (NBP1-88103).
| Research Areas for CD45 Antibody (NBP1-88103)Find related products by research area.
|
The application of CD31/Pecam-1 (MEC 7.46) in breast cancer research CD31/PECAM-1, or platelet endothelial cell adhesion molecule 1, is a 130-kDa glycoprotein expressed on vascular and hematopoietic cells. Depending on the cell type, CD31/PECAM-1 expression can be largely localized to cell junctions, playing a rol... Read full blog post. |
CD45 - Much more than just a housekeeping protein CD45, also known as T200 or the Leukocyte Common Antigen (LCA), is encoded by the Protein Tyrosine Phosphatase Receptor type C (PTPRC) gene. The protein is expressed exclusively on cells of the haematopoietic system, and is one of the most abundant le... Read full blog post. |
CD45 Isoforms: Hematopoietic Differentiation, Cancer and Alzheimer's CD45, also known as protein tyrosine phosphatase, receptor type, C (PTPRC), was originally known as common leukocyte antigen and is a signal transducer involved in many physiological processes such as growth and differentiation, cancer transformation,... Read full blog post. |
Vimentin Antibodies in Rheumatoid Arthritis & Cataracts Research Vimentin is a 57kDa type III intermediate filament (IF) protein that is the major cytoskeletal component of mesenchymal cells and the first to be expressed during cell differentiation. It plays a significant role in supporting and anchoring the positi... Read full blog post. |
Antibodies In The Differential Diagnosis Of Undifferentiated Tumors Immunohistochemical testing using antibody panels has a valuable role in cancer diagnosis. Some tumors, especially more malignant ones, tend to lose the appearance of the tissue of origin. However, knowing the tissue of origin assists the physician in... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.