Home » CD45 » CD45 Antibodies » CD45 Antibody

CD45 Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: CD45 Antibody [NBP1-88103] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-431. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue.
Western Blot: CD45 Antibody [NBP1-88103] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-431. Lane 5: Human liver tissue. ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: CD45 Antibody [NBP1-88103] - Staining in human tonsil and pancreas tissues using anti-CD45 antibody. Corresponding CD45 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: CD45 Antibody [NBP1-88103] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: CD45 Antibody [NBP1-88103] - Staining of human tonsil shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

CD45 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMT
Specificity
Specificity of human CD45 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTPRC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD45 Recombinant Protein Antigen (NBP1-88103PEP)
Publications
Read Publications using NBP1-88103.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD45 Antibody

  • B220
  • CD45 antigen
  • CD45
  • CD45R
  • EC 3.1.3.48
  • LCA
  • L-CA
  • LY5
  • protein tyrosine phosphatase, receptor type, C
  • PTPRC
  • receptor-type tyrosine-protein phosphatase C
  • T200 Glycoprotein
  • T200 leukocyte common antigen
  • T200receptor type, c polypeptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(2 Reviews)
(1 Publication)
Species: Hu
HLA DQA1 Antibody
NBP1-84550
Western Blot: HLA DQA1 Antibody [NBP1-84550] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line Daudi.
Immunohistochemistry-Paraffin: HLA DQA1 Antibody [NBP1-84550] - Staining of human lung shows high expression.
Immunohistochemistry-Paraffin: HLA DQA1 Antibody [NBP1-84550] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
Species: Hu
Applications: WB, IHC, IHC-P
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-NOD2 (2D9) NB100-524 at a 1:200 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(16 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
CD4 Antibody
NBP1-19371
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.
Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with DyLight 488 (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
(8 Reviews)
(14 Publications)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Mouse CD3+ T Cell,
Small Column Enrichme ...
MTCC-10-NOV
Mouse CD3+ T Cell, Small Column Enrichment Kit
CD34 Antibody (MEC
14.7)
NB600-1071
Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry-Paraffin: CD34 Antibody (MEC 14.7) [NB600-1071] - Analysis of a FFPE tissue section of mouse small intestine using rat anti-mouse CD34 (clone MEC 14.7) at 1:100 dilution. The signal was developed using HRP-conjugated anti-rat secondary with DAB reagent which followed counterstaining of nuclei using hematoxylin. This antibody specifically labelled the endothelial cells in blood vessels located primarily in the sub-mucosa, and of that of the mucosa muscularis and the mucosal lacteal.
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 (MEC 14.7) antibody was tested at 1:250 in WEHI-3 cells with DyLight 488 (green) alongside a matched isotype control (black).
(18 Publications)
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
CD8 Antibody
(53-6.7)
NBP1-49045
Immunocytochemistry/Immunofluorescence: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of immersion fixed splenocytes. Primary antibody was used at a dilution of 10 ug/mL and incubated for 3 hours at room temperature.
Immunohistochemistry-Frozen: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of CD8+ T cells in allogeneic skin grafted onto a mouse.
Flow Cytometry: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of lymph nodes by multiple staining.
(2 Reviews)
(11 Publications)
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
IL-2 [Unconjugated]
202-IL
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
(13 Reviews)
(244 Publications)
Species: Hu
IL-4
6507-IL/CF
IL-4
(2 Publications)
Species: Hu
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(21 Reviews)
(529 Publications)
Species: Hu
CD20 Antibody
(AISB12)
NBP1-43435
Western Blot: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Immunoblot of Balb/c thymus (lane 1) and A20 (lane 2) cell lysates with Anti-Mouse CD20 Purified.
Flow Cytometry: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Staining of BALB/c splenocytes with Anti-Mouse CD19 Alexa Fluor (R) 647 and 1.0 micrograms conjugated anti-Mouse CD20 Purified followed by Anti-Rat IgG PE. Quadrant lines represent Rat IgG2a isotype control staining levels and cells in the lymphocyte gate were used for analysis.
(3 Publications)
Species: Hu, Mu
Applications: WB, Flow
Cytokeratin 20
Antibody
NBP1-85599
Western Blot: Cytokeratin 20 Antibody [NBP1-85599] - Analysis in human small intestine tissue.
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599] - Analysis in human small intestine and liver tissues. Corresponding KRT20 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599] - Staining of human liver shows no positivity in hepatocytes as expected
Species: Hu
Applications: WB, IHC, IHC-P
CD11b Antibody
NB110-89474
Immunohistochemistry: CD11b Antibody [NB110-89474] - Staining of mouse pancreas using CD11b antibody at 1:400 dilution. Nuclei counterstained with DAPI (blue). Image from product review by verified customer.
Immunocytochemistry/Immunofluorescence: CD11b Antibody [NB110-89474] - CD11b antibody was tested in Raw264.7 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Simple Western: CD11b Antibody [NB110-89474] - Specific band for Cd11b in 1.0 mg/mL of Dentate Gyrus from Rat Brain. Antibody at 1:50. This experiment was performed under reducing conditions using the 12-230 kDa separation system. Image from verified customer review.
(9 Reviews)
(40 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single Cell Western
CD44 Antibody
(8E2F3)
NBP1-47386
Immunocytochemistry/Immunofluorescence: CD44 Antibody (8E2F3) [NBP1-47386] - Analysis of paraffin-embedded human lung cancer tissues using anti-CD44 mAb (green), showing membrane localization. DRAQ5 fluorescent DNA dye (blue).
Immunohistochemistry-Paraffin: CD44 Antibody (8E2F3) [NBP1-47386] - Analysis of FFPE human breast carcinoma tissues using CD44 antibody (8E2F3). The signal was developed using DAB based detection and the sections were processed for counterstaining with hematoxylin. The antibody generated mainly a membrane staining representative of CD44 protein.
Flow Cytometry: CD44 Antibody (8E2F3) [NBP1-47386] - Analysis of HeLa cells using anti-CD44 mAb (right) and negative control (left).
(1 Review)
(8 Publications)
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
IL-6 [Unconjugated]
7270-IL/CF
IL-6 [Unconjugated]
Species: Hu
CD19 Antibody
(CB19)
NBP2-25196
Immunocytochemistry/Immunofluorescence: CD19 Antibody (CB19) [NBP2-25196] - The CD19 (CB19) antibody was tested in Daudi cells at a 1:40 dilution against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 568 (Red) and DAPI (Blue), respectively.
Flow Cytometry: CD19 Antibody (CB19) [NBP2-25196] - A surface stain was performed on Ramos cells with CD19 Antibody (CB19) NBP2-26646 (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 2.5 ug/mL for 20 minutes at room temperature. Both antibodies were conjugated to phycoerythrin.
Flow Cytometry: CD19 Antibody (CB19) [NBP2-25196] - Surface staining of 10^6 human lymphocytes using 0.2 ug of CD19 antibody (red) and isotype control (green). Cell surface staining kit was used for this test.
(10 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, In vitro, CyTOF-ready
IFN-gamma
[Unconjugated]
285-IF
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is 0.15‑0.75 ng/mL.
(8 Reviews)
(271 Publications)
Species: Hu
NDUFA2 Knockout
HeLa Cell Lysate
NBP2-66200
NDUFA2 Knockout HeLa Cell Lysate
Species: Hu
Integrin beta
1/CD29 Antibody (P4C1
NBP2-36561
Immunocytochemistry/Immunofluorescence: Integrin beta 1/CD29 Antibody (P4C10) [NBP2-36561] - Integrin beta 1 (P4C10) antibody was tested in -20 degree MeOH fixed HeLa cells at a 1:200 dilution against DyLight 488 (green). Actin and nuclei were counterstained against Phalloidin 568 (red) and DAPI (blue), respectively.
Flow Cytometry: Integrin beta 1/CD29 Antibody (P4C10) [NBP2-36561] - A surface stain was performed on HeLa cells with Integrin beta 1/CD29 [P4C10] Antibody NBP2-36561PE (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 2.5 ug/mL for 20 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
Flow Cytometry: Integrin beta 1/CD29 Antibody (P4C10) [NBP2-36561]
(10 Publications)
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N
CD45 Antibody
NBP1-88103
CD45 Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CD45 Antibody (NBP1-88103)(2)


Reviews for CD45 Antibody (NBP1-88103) (0)

There are no reviews for CD45 Antibody (NBP1-88103). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD45 Antibody (NBP1-88103). (Showing 1 - 3 of 3 FAQs).

  1. We are interested in CD45 antibodies that could react with dog, please let me know which products in your catalog you would recommend.
    • I would recommend one of these CD45 antibodies to you, as these have all been validated for use with dog/canine samples.
  2. We would like to order a CD45 antibody to stain immune cells that were isolated from a ligated sciatic nerve of mice with double immunofluorescence (using PFA-fixed tissue on slides). Which of the following rat monoclonal CD45 antibodies would you recommend: 30-F11, IBL-3/16 or 5C16?
    • I would recommend clone 30-F11. As clone IBL-3/16 has not yet been validated for IHC-P application, we would not be able to guarantee its workability on PFA-fixed tissue. Although both other clones i.e. 30-F11 and 5C16, would be good for your samples, CD45 30-F11 # NB100-77417 is a well known clone that offers more flexibility around protocol because of availability of its conjugated forms. It would be advantageous to use a conjugated primary as you are planning for double-immunostaining procedure.
  3. Do you have any information about antigen retrieval for NBP1-88103?
    • We recommend HIER in citrate buffer with a pH of 6.0 for this product. Please see our Antigen Retrieval Protocol for detailed imformation.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CD45 Antibody (NBP1-88103)

Discover related pathways, diseases and genes to CD45 Antibody (NBP1-88103). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD45 Antibody (NBP1-88103)

Discover more about diseases related to CD45 Antibody (NBP1-88103).
 

Pathways for CD45 Antibody (NBP1-88103)

View related products by pathway.

PTMs for CD45 Antibody (NBP1-88103)

Learn more about PTMs related to CD45 Antibody (NBP1-88103).
 

Research Areas for CD45 Antibody (NBP1-88103)

Find related products by research area.

Blogs on CD45.

Check out the latest blog posts on CD45.
You complete me: Natural killer cells need TGF-beta inhibition to effectively combat cancers
By Jamshed Arslan Pharm.D. Natural killer (NK) cells are lymphocytes of the innate immune system that were first discovered for their “natural” ability to kill cancer cells. To use NK cells as anti-cancer therapy, t...  Read full blog post.
The application of CD31/Pecam-1 (MEC 7.46) in breast cancer research
CD31/PECAM-1, or platelet endothelial cell adhesion molecule 1, is a 130-kDa glycoprotein expressed on vascular and hematopoietic cells.  Depending on the cell type, CD31/PECAM-1 expression can be largely localized to cell junctions, playing a rol...  Read full blog post.
CD45 - Much more than just a housekeeping protein
CD45, also known as T200 or the Leukocyte Common Antigen (LCA), is encoded by the Protein Tyrosine Phosphatase Receptor type C (PTPRC) gene. The protein is expressed exclusively on cells of the haematopoietic system, and is one of the most abundant le...  Read full blog post.
CD45 Isoforms: Hematopoietic Differentiation, Cancer and Alzheimer's
CD45, also known as protein tyrosine phosphatase, receptor type, C (PTPRC), was originally known as common leukocyte antigen and is a signal transducer involved in many physiological processes such as growth and differentiation, cancer transformation,...  Read full blog post.
Vimentin Antibodies in Rheumatoid Arthritis & Cataracts Research
Vimentin is a 57kDa type III intermediate filament (IF) protein that is the major cytoskeletal component of mesenchymal cells and the first to be expressed during cell differentiation. It plays a significant role in supporting and anchoring the positi...  Read full blog post.
Antibodies In The Differential Diagnosis Of Undifferentiated Tumors
Immunohistochemical testing using antibody panels has a valuable role in cancer diagnosis. Some tumors, especially more malignant ones, tend to lose the appearance of the tissue of origin. However, knowing the tissue of origin assists the physician in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD45 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PTPRC