Recombinant Human CD40/TNFRSF5 Protein

Images

 
Western Blot: CD40 Protein [NBP1-46078] - A sample of CD40 (167aa) - Fc HCX Chimera without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. Approximately 40 ...read more
Western Blot: CD40 Protein [NBP1-46078] - Lane 1 - MW markers; Lane 2 - CD40 (167aa) - Fc Chimera; Lane 3 - CD40 (167aa) - Fc Chimera treated with PNGase F to remove potential N-linked glycans; Lane 4 - CD40 (167aa) ...read more
Densitometry: CD40 Protein [NBP1-46078] - Post-translational modifications result in protein heterogeneity. The densitometry scan demonstrates the purified human cell expressed protein exists in multiple glycoforms, ...read more

Product Details

Summary
Product Discontinued
View other related CD40/TNFRSF5 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-46078
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human CD40/TNFRSF5 Protein Summary

Description
A biologically active protein corresponding to 173 residues of CD40.

Amino Acid Sequence: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGRSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Preparation
Method
A DNA sequence encoding the signal peptide and extracellular domain of human CD40 (aa 1-193) was fused to the Fc region of human IgG1 (aa 90-330). The chimeric protein was expressed in modified human 293 cells.
Details of Functionality
The ED50 of CD40 (173aa) Fc HCX Chimera is typically 1.0-1.5 ug/ml as measured by its ability to neutralize CD40 ligand mediated proliferation of T47-D cells.
Protein/Peptide Type
Biologically Active Protein
Gene
CD40

Applications/Dilutions

Application Notes
This protein is functionally active and can be used for Blocking and Neutralizing. It can also be used for Western Blot. CD40 (173aa) - Fc HCX Chimera separates into a number of glycoforms with an observed pI between 5.5 and 9.0 in 2D PAGE due to post-translational modifications, inparticular glycosylation. This compares with the unmodified CD40 (173aa) - Fc Chimera thathas a predicted pI of 6.0. CD40 (173aa) - Fc HCX Chimera contains N-linked oligosaccharides and may contain O-linked oligosaccharides. Under reducing conditions Symansis CD40 (173aa) - Fc HCX Chimera migrates as a broad band between 50 and 65 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified CD40 (173aa) - Fc Chimera that has a predicted monomeric molecular mass of 46.5 kDa.

Reactivity Notes

This is a Human protein

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Concentration
LYOPH
Reconstitution Instructions
Reconstitute with 0.5 ml sterilized PBS containing 1% human serum albumin and 10% trehalose.

Alternate Names for Recombinant Human CD40/TNFRSF5 Protein

  • B cell surface antigen CD40
  • B-cell surface antigen CD40
  • Bp50B cell-associated molecule
  • CD40 antigen
  • CD40 molecule, TNF receptor superfamily member 5
  • CD40 type II isoform
  • CD40
  • CD40L receptor
  • CDw40
  • MGC9013
  • nerve growth factor receptor-related B-lymphocyte activation molecule
  • p50
  • TNFRSF5
  • TNFRSF5CD40 antigen (TNF receptor superfamily member 5)
  • tumor necrosis factor receptor superfamily member 5
  • tumor necrosis factor receptor superfamily, member 5

Background

CD40 (TNFRSF5, CD40L Receptor) is a type I membrane protein and a member of the TNF receptor family. CD40 is expressed on B cells, monocytes, dendritic cells, endothelial cells, epithelial cells and B cell lymphomas and carcinomas. CD40 activates mulitple signalling pathways and can promote cell survival through up-regulation of the expression of genes encoding anti-apoptopic proteins. This is a HCX protein. HCX Expression System Details HCX proteins mimic the proteins in the human body because they are expressed from human, rather than animal, insect or bacterial cells. This process gives them human post-translational modifications. Recombinant DNA techniques allow a human protein with the correct amino acid sequence to be expressed in a non-human cell line. However, non-human cells lack the appropriate cellular machinery, such as specific glycosyltransferases, necessary to produce the correct human post-translational modifications of a protein. An extreme example is seen in E. coli cells, which produce recombinant proteins with no glycosylation, as the above figure illustrates. Rodent and yeast cells are able to glycosylate proteins, but they are still different from glycosylation in human cells. Expression System Resultant Proteins Human (e.g. K562, HEK293) Correct amino acid sequence Human post-translational modifications Rodent (e.g. CHO, NSO) Correct amino acid sequence Some natural glycosylation - not human-like Yeast (e.g. Pichia) Correct amino acid sequence Some natural glycosylation - not human-like E.Coli Correct amino acid sequence No PTMs Although there have been significant attempts to make non-human cell derived cytokines more human-like, there is a growing awareness that in many instances, particularly in therapeutics, cytokines should mimic those found in the body as closely as possible. Purified CD40 (173aa) - Fc HCX Chimera consists of 5 to 30% carbohydrate by weight.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 2 years from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
796-IC
Species: Mu
NBP1-46078
Species: Hu
Applications: WB, B/N, Func

Publications for CD40/TNFRSF5 Protein (NBP1-46078) (0)

There are no publications for CD40/TNFRSF5 Protein (NBP1-46078).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD40/TNFRSF5 Protein (NBP1-46078) (0)

There are no reviews for CD40/TNFRSF5 Protein (NBP1-46078). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD40/TNFRSF5 Protein (NBP1-46078). (Showing 1 - 2 of 2 FAQ).

  1. I wanna know does CD40 antibody for IHC-P comes with positive control slide?
    • Our CD40 antibodies do not come with positive control slides however you can use any type of primary carcinoma cell as a positive control. I recommend breast carcinoma as this is what we have tested our CD40 antibodies on.
  2. We are studying CD40L in our system. It has been known that both CD40 and CD11b are receptors for CD40L. We need CD40 antibody to neutralize CD40 binding to CD40L, then we may prove what is function for CD11b binding to CD40L. Do you have any CD40 Ab which has block function only between CD40 and CD40L, but not between CD11b and CD40L?
    • Unfortunately, none of our CD40 antibodies have been specifically tested for this application.

Additional CD40/TNFRSF5 Products

Bioinformatics Tool for CD40/TNFRSF5 Protein (NBP1-46078)

Discover related pathways, diseases and genes to CD40/TNFRSF5 Protein (NBP1-46078). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD40/TNFRSF5 Protein (NBP1-46078)

Discover more about diseases related to CD40/TNFRSF5 Protein (NBP1-46078).
 

Pathways for CD40/TNFRSF5 Protein (NBP1-46078)

View related products by pathway.

PTMs for CD40/TNFRSF5 Protein (NBP1-46078)

Learn more about PTMs related to CD40/TNFRSF5 Protein (NBP1-46078).
 

Research Areas for CD40/TNFRSF5 Protein (NBP1-46078)

Find related products by research area.

Blogs on CD40/TNFRSF5

There are no specific blogs for CD40/TNFRSF5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CD40/TNFRSF5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CD40
Entrez