CD34 Antibody


Western Blot: CD34 Antibody [NBP2-38321] - Analysis in human cell line MOLT-4.
Immunohistochemistry: CD34 Antibody [NBP2-38321] - Staining of human kidney shows strong positivity in Blood vessels / endothelial cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CD34 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: ATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAG
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD34 Protein (NBP2-38321PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CD34 Antibody

  • CD34 antigenhematopoietic progenitor cell antigen CD34
  • CD34 molecule
  • CD34
  • HPCA1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, ELISA, PLA
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
Species: Hu
Applications: WB, ChIP, ELISA
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for CD34 Antibody (NBP2-38321) (0)

There are no publications for CD34 Antibody (NBP2-38321).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD34 Antibody (NBP2-38321) (0)

There are no reviews for CD34 Antibody (NBP2-38321). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD34 Antibody (NBP2-38321). (Showing 1 - 1 of 1 FAQ).

  1. I wonder if you have a CD105 or CD34 antibody suitable for IHC that is specific for human and do not bind mouse?
    • We do not have any anti-human CD34 or CD105 antibodies that are confirmed to NOT detect the mouse protein. When we have tested an antibody and confirmed that it will not react with mouse samples, we will add Mu(-) to the datasheet, and unfortunately all of our CD105 and CD34 antibodies will either detect the mouse protein, or they have not been used in mouse samples before.

Secondary Antibodies


Isotype Controls

Additional CD34 Products

Bioinformatics Tool for CD34 Antibody (NBP2-38321)

Discover related pathways, diseases and genes to CD34 Antibody (NBP2-38321). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD34 Antibody (NBP2-38321)

Discover more about diseases related to CD34 Antibody (NBP2-38321).

Pathways for CD34 Antibody (NBP2-38321)

View related products by pathway.

PTMs for CD34 Antibody (NBP2-38321)

Learn more about PTMs related to CD34 Antibody (NBP2-38321).

Research Areas for CD34 Antibody (NBP2-38321)

Find related products by research area.

Blogs on CD34.

The application of CD31/Pecam-1 (MEC 7.46) in breast cancer research
CD31/PECAM-1, or platelet endothelial cell adhesion molecule 1, is a 130-kDa glycoprotein expressed on vascular and hematopoietic cells.  Depending on the cell type, CD31/PECAM-1 expression can be largely localized to cell junctions, playing a rol...  Read full blog post.

CD68 (Cluster of differentiation 68, GP110, LAMP4, SCARD1)
CD68 belongs to a growing family of hematopoietic mucin-like molecules known as lysosomal/endosomal-associated membrane glycoproteins (LAMPs). Other LAMP family members included leukosialin, stem cell antigen CD34, and GlyCAM-1. CD68 encodes a 110-kD...  Read full blog post.

CD34 (Cluster of differentiation 34, hematopoietic progenitor cell antigen)
CD34 is a cell-surface glycoprotein type 1 transmembrane protein that belongs to the sialomucin family. CD34 comprises of an intracellular cytoplasmic domain with consensus sites for serine, threonine, tyrosine and active protein kinase C (PKC). Becau...  Read full blog post.

CD34 Serves as an Important Marker in Disease Research
CD34 is a membrane protein that aids cells in cell-cell adhesion. Although little is known about its function, CD34 is an important marker for hematopoietic stem cells (HSCs), muscle satellite cells, and endothelial cells. HSCs can be found in bone ma...  Read full blog post.

CD34 Serves as an Important Marker in Disease Research
CD34 is a cell surface glycoprotein that aids cells in cell-cell adhesion. It is expressed on endothelial cells where it is known to bind L-selectin and may aid in migration of T-cells. Moreover, it is expressed on hematopoietic stem cells (HSC), musc...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CD34 Antibody and receive a gift card or discount.


Gene Symbol CD34