CD30/TNFRSF8 Antibody (2E2.)

Images

 
Sandwich ELISA: CD30/TNFRSF8 Antibody (2E2) [H00000943-M03] - Detection limit for recombinant GST tagged TNFRSF8 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related CD30/TNFRSF8 Primary Antibodies

Order Details


    • Catalog Number
      H00000943-M03
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CD30/TNFRSF8 Antibody (2E2.) Summary

Immunogen
TNFRSF8 (NP_001234, 21 a.a. - 133 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPA
Specificity
TNFRSF8 - tumor necrosis factor receptor superfamily, member 8 (2E2)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TNFRSF8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD30/TNFRSF8 Antibody (2E2.)

  • CD30 antigen
  • CD30
  • CD30KI-1
  • CD30L receptor
  • cytokine receptor CD30
  • D1S166EKi-1
  • Ki-1 antigen
  • Lymphocyte activation antigen CD30
  • TNFRSF8
  • tumor necrosis factor receptor superfamily member 8
  • tumor necrosis factor receptor superfamily, member 8

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF1028
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF4210
Species: Hu
Applications: WB, IHC

Publications for CD30/TNFRSF8 Antibody (H00000943-M03) (0)

There are no publications for CD30/TNFRSF8 Antibody (H00000943-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD30/TNFRSF8 Antibody (H00000943-M03) (0)

There are no reviews for CD30/TNFRSF8 Antibody (H00000943-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD30/TNFRSF8 Antibody (H00000943-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD30/TNFRSF8 Products

Bioinformatics Tool for CD30/TNFRSF8 Antibody (H00000943-M03)

Discover related pathways, diseases and genes to CD30/TNFRSF8 Antibody (H00000943-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD30/TNFRSF8 Antibody (H00000943-M03)

Discover more about diseases related to CD30/TNFRSF8 Antibody (H00000943-M03).
 

Pathways for CD30/TNFRSF8 Antibody (H00000943-M03)

View related products by pathway.

Research Areas for CD30/TNFRSF8 Antibody (H00000943-M03)

Find related products by research area.

Blogs on CD30/TNFRSF8

There are no specific blogs for CD30/TNFRSF8, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD30/TNFRSF8 Antibody (2E2.) and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFRSF8
Entrez
Uniprot