Recombinant Human CD3 zeta Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CD3 zeta Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-164 of Human CD3Z full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Protein/Peptide Type
Recombinant Protein
Gene
CD247

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD3 zeta Protein

  • CD247 antigen
  • CD247 antigen, zeta subunit
  • CD247 molecule
  • CD247
  • CD3 zeta
  • CD3H
  • CD3Q
  • CD3z antigen, zeta polypeptide (TiT3 complex)
  • CD3Z
  • CD3ZT-cell receptor T3 zeta chain
  • IMD25
  • T3Z
  • T-cell antigen receptor complex, zeta subunit of CD3
  • T-cell surface glycoprotein CD3 zeta chain
  • TCR Zeta Chain
  • TCRZCD3-ZETA

Background

CD3 (Cluster of Differentiation 3) is a complex of proteins that associates directly with the T cell antigen receptor (TCR). Antigen binding to the TCR leads to IL-2 secretion via activation of a tyrosine phosphorylation pathway and a phospholipase C (PLC) pathway, in turn activating protein kinase C. CD3 is composed of five invariant polypeptide chains that associate to form three dimers. The five invariant chains of CD3 are labeled gamma, delta, epsilon, zeta, and eta. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Loss of the zeta chain results in the synthesis of unstable TCRs. A decrease of CD3 zeta has been described in T cells from patients with cancer, lupus and chronic infectious diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB7500
Species: Hu
Applications: WB, ICC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
MAB100
Species: Hu
Applications: Flow, IP, CyTOF-reported, ICC, Tstim
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB342
Species: Hu
Applications: WB, AgAct
NBP1-27946
Species: Mu
Applications: B/N, Flow, IHC-Fr, IP
NBP2-32636
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
MAB2546
Species: Hu
Applications: Flow, CyTOF-ready
126-FL/CF
Species: Hu
NBP1-84084
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB139
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
NBP2-46218
Species: Hu
Applications: WB, IHC

Publications for CD3 zeta Recombinant Protein (H00000919-P01) (0)

There are no publications for CD3 zeta Recombinant Protein (H00000919-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD3 zeta Recombinant Protein (H00000919-P01) (0)

There are no reviews for CD3 zeta Recombinant Protein (H00000919-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD3 zeta Recombinant Protein (H00000919-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD3 zeta Products

Bioinformatics Tool for CD3 zeta Recombinant Protein (H00000919-P01)

Discover related pathways, diseases and genes to CD3 zeta Recombinant Protein (H00000919-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD3 zeta Recombinant Protein (H00000919-P01)

Discover more about diseases related to CD3 zeta Recombinant Protein (H00000919-P01).
 

Pathways for CD3 zeta Recombinant Protein (H00000919-P01)

View related products by pathway.

PTMs for CD3 zeta Recombinant Protein (H00000919-P01)

Learn more about PTMs related to CD3 zeta Recombinant Protein (H00000919-P01).
 

Research Areas for CD3 zeta Recombinant Protein (H00000919-P01)

Find related products by research area.

Blogs on CD3 zeta

There are no specific blogs for CD3 zeta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CD3 zeta Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CD247
Entrez