CD2BP2 Antibody


Western Blot: CD2BP2 Antibody [NBP2-87163] - Host: Rabbit. Target Name: CD2BP2. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CD2BP2 Antibody Summary

The immunogen is a synthetic peptide directed towards the N-terminal region of human CD2BP2. Peptide sequence: KHSLDSDEEEDDDDGGSSKYDILASEDVEGQEAATLPSEGGVRITPFNLQ The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for CD2BP2 Antibody

  • CD2 (cytoplasmic tail) binding protein 2
  • CD2 antigen (cytoplasmic tail) binding protein 2
  • CD2 antigen (cytoplasmic tail)-binding protein 2
  • CD2 antigen cytoplasmic tail-binding protein 2
  • CD2 binding protein 2
  • CD2 cytoplasmic domain binding protein 2
  • CD2 cytoplasmic domain-binding protein 2
  • CD2 tail-binding protein 2
  • FWP010
  • KIAA1178
  • LIN1
  • Snu40
  • U5 snRNP 52K protein
  • U5-52K


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu
Applications: WB

Publications for CD2BP2 Antibody (NBP2-87163) (0)

There are no publications for CD2BP2 Antibody (NBP2-87163).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD2BP2 Antibody (NBP2-87163) (0)

There are no reviews for CD2BP2 Antibody (NBP2-87163). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD2BP2 Antibody (NBP2-87163) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CD2BP2 Products

Bioinformatics Tool for CD2BP2 Antibody (NBP2-87163)

Discover related pathways, diseases and genes to CD2BP2 Antibody (NBP2-87163). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD2BP2 Antibody (NBP2-87163)

Discover more about diseases related to CD2BP2 Antibody (NBP2-87163).

Pathways for CD2BP2 Antibody (NBP2-87163)

View related products by pathway.

Research Areas for CD2BP2 Antibody (NBP2-87163)

Find related products by research area.

Blogs on CD2BP2

There are no specific blogs for CD2BP2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CD2BP2 Antibody and receive a gift card or discount.


Gene Symbol CD2BP2