CD24 Antibody (1C4)

Images

 
Sandwich ELISA: CD24 Antibody (1C4) [H00000934-M04] - Detection limit for recombinant GST tagged CD24 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CD24 Antibody (1C4) Summary

Immunogen
CD24 (AAH07674, 1 a.a. - 80 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Specificity
CD24 - CD24 antigen (small cell lung carcinoma cluster 4 antigen) (1C4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CD24
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD24 Antibody (1C4)

  • CD 24
  • CD24 antigen (small cell lung carcinoma cluster 4 antigen)
  • CD24 antigen
  • CD24 molecule
  • CD24
  • CD24A
  • CD24Asignal transducer CD24
  • FLJ22950
  • FLJ43543
  • MGC75043
  • Small cell lung carcinoma cluster 4 antigen

Background

This gene encodes a sialoglycoprotein that is expressed on mature granulocytes and in many B cells. The encoded protein is anchored via a glycosyl phosphatidylinositol (GPI) link to the cell surface. An alignment of this gene's sequence finds genomic locations with similarity on chromosomes 3p26, 15q21, 15q22, 20q11.2 and Yq11.1. Whether transcription, and corresponding translation, occurs at each of these other genomic locations needs to be experimentally determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB120-16518
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00005018-D01P
Species: Hu
Applications: WB, ICC/IF
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
H00000934-M04
Species: Hu
Applications: WB, ELISA

Publications for CD24 Antibody (H00000934-M04) (0)

There are no publications for CD24 Antibody (H00000934-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD24 Antibody (H00000934-M04) (0)

There are no reviews for CD24 Antibody (H00000934-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD24 Antibody (H00000934-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD24 Products

Bioinformatics Tool for CD24 Antibody (H00000934-M04)

Discover related pathways, diseases and genes to CD24 Antibody (H00000934-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD24 Antibody (H00000934-M04)

Discover more about diseases related to CD24 Antibody (H00000934-M04).
 

Pathways for CD24 Antibody (H00000934-M04)

View related products by pathway.

PTMs for CD24 Antibody (H00000934-M04)

Learn more about PTMs related to CD24 Antibody (H00000934-M04).

Blogs on CD24.

Tools for Isolation, Quantification and Analysis of Exosomes
Exosomes are spherical to cup-shaped bilayered membrane enclosed nanosize vesicles (30-100 nm) which have the ability to shuttle active cargoes between cells. Johnstone et al. 1987 pioneered in documenting the generation of exosomes in differentiat...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD24 Antibody (1C4) and receive a gift card or discount.

Bioinformatics

Gene Symbol CD24
Entrez