CD23/Fc epsilon RII Antibody

Images

 
Western Blot: CD23/Fc epsilon RII Antibody [H00002208-D01P] - Analysis of FCER2 expression in transfected 293T cell line by FCER2 polyclonal antibody.Lane 1: FCER2 transfected lysate(36.50 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Product Discontinued
View other related CD23/Fc epsilon RII Primary Antibodies

Order Details


    • Catalog Number
      H00002208-D01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CD23/Fc epsilon RII Antibody Summary

Immunogen
FCER2 (NP_001993.2, 1 a.a. - 321 a.a.) full-length human protein. MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Specificity
FCER2 - Fc fragment of IgE, low affinity II, receptor for (CD23),
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FCER2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD23/Fc epsilon RII Antibody

  • BLAST-2
  • CD23
  • CD23A
  • CD23CD23 antigen
  • CLEC4J
  • CLEC4JC-type lectin domain family 4 member J
  • C-type lectin domain family 4, member J
  • Fc epsilon RII
  • Fc fragment of IgE, low affinity II, receptor for (CD23)
  • FCE2Fc fragment of IgE, low affinity II, receptor for (CD23A)
  • fc-epsilon-RII
  • FCER2
  • Fcer2a
  • FceRII
  • IGEBF
  • Immunoglobulin E-binding factor
  • low affinity immunoglobulin epsilon Fc receptor
  • Ly-42
  • Lymphocyte IgE receptor

Background

The human leukocyte differentiation antigen CD23 (FCE2) is a key molecule for B-cell activation and growth. It is the low-affinity receptor for IgE. The truncated molecule can be secreted, then functioning as a potent mitogenic growth factor.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-02690
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
H00002208-D01P
Species: Hu
Applications: WB

Publications for CD23/Fc epsilon RII Antibody (H00002208-D01P) (0)

There are no publications for CD23/Fc epsilon RII Antibody (H00002208-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD23/Fc epsilon RII Antibody (H00002208-D01P) (0)

There are no reviews for CD23/Fc epsilon RII Antibody (H00002208-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD23/Fc epsilon RII Antibody (H00002208-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD23/Fc epsilon RII Products

Bioinformatics Tool for CD23/Fc epsilon RII Antibody (H00002208-D01P)

Discover related pathways, diseases and genes to CD23/Fc epsilon RII Antibody (H00002208-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD23/Fc epsilon RII Antibody (H00002208-D01P)

Discover more about diseases related to CD23/Fc epsilon RII Antibody (H00002208-D01P).
 

Pathways for CD23/Fc epsilon RII Antibody (H00002208-D01P)

View related products by pathway.

Research Areas for CD23/Fc epsilon RII Antibody (H00002208-D01P)

Find related products by research area.

Blogs on CD23/Fc epsilon RII

There are no specific blogs for CD23/Fc epsilon RII, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD23/Fc epsilon RII Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FCER2
Entrez
Uniprot