Recombinant Human CD200 R1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related CD200 R1 Peptides and Proteins

Order Details


    • Catalog Number
      H00131450-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human CD200 R1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 73 - 172 of Human CD200R1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDLQIRTVAITHDGYYRCIMVTPDGNFHRGYHLQVLVTPEVTLFQNRNRTAVCKAVAG

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
CD200R1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD200 R1 Protein

  • CD200 R1
  • CD200 receptor 1
  • CD200R1
  • CD200RMOX2Rcell surface glycoprotein CD200 receptor 1
  • Cell surface glycoprotein OX2 receptor 1
  • cell surface glycoprotein receptor CD200
  • CRTR2
  • HCRTR2
  • MOX2 receptor
  • MOX2R
  • OX2RCD200 cell surface glycoprotein receptor

Background

This gene encodes a receptor for the OX-2 membrane glycoprotein. Both the receptor and substrate are cell surface glycoproteins containing two immunoglobulin-like domains. This receptor is restricted to the surfaces of myeloid lineage cells and the receptor-substrate interaction may function as a myeloid downregulatory signal. Mouse studies of a related gene suggest that this interaction may control myeloid function in a tissue-specific manner. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2724
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
MAB763
Species: Hu, Mu, Rt
Applications: IHC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-00948
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00131450-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for CD200 R1 Partial Recombinant Protein (H00131450-Q01) (0)

There are no publications for CD200 R1 Partial Recombinant Protein (H00131450-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD200 R1 Partial Recombinant Protein (H00131450-Q01) (0)

There are no reviews for CD200 R1 Partial Recombinant Protein (H00131450-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD200 R1 Partial Recombinant Protein (H00131450-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD200 R1 Products

Bioinformatics Tool for CD200 R1 Partial Recombinant Protein (H00131450-Q01)

Discover related pathways, diseases and genes to CD200 R1 Partial Recombinant Protein (H00131450-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD200 R1 Partial Recombinant Protein (H00131450-Q01)

Discover more about diseases related to CD200 R1 Partial Recombinant Protein (H00131450-Q01).
 

Pathways for CD200 R1 Partial Recombinant Protein (H00131450-Q01)

View related products by pathway.

PTMs for CD200 R1 Partial Recombinant Protein (H00131450-Q01)

Learn more about PTMs related to CD200 R1 Partial Recombinant Protein (H00131450-Q01).

Blogs on CD200 R1

There are no specific blogs for CD200 R1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CD200 R1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CD200R1
Entrez