CD200 R1 Antibody


Western Blot: CD200R Antibody [NBP1-68990] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB
Please see the vial label for concentration. If unlisted please contact technical services.

Order Details

CD200 R1 Antibody Summary

Synthetic peptides corresponding to CD200R1 (CD200 receptor 1) The peptide sequence was selected from the N terminal of CD200R1. Peptide sequence NLIIITWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified


Application Notes
This is a rabbit polyclonal antibody against CD200R1 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
39 kDa


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CD200 R1 Antibody

  • CD200 R1
  • CD200 receptor 1
  • CD200R1
  • CD200RMOX2Rcell surface glycoprotein CD200 receptor 1
  • Cell surface glycoprotein OX2 receptor 1
  • cell surface glycoprotein receptor CD200
  • CRTR2
  • HCRTR2
  • MOX2 receptor
  • MOX2R
  • OX2RCD200 cell surface glycoprotein receptor


This gene encodes a receptor for the OX-2 membrane glycoprotein. Both the receptor and substrate are cell surface glycoproteins containing two immunoglobulin-like domains. This receptor is restricted to the surfaces of myeloid lineage cells and the receptor-substrate interaction may function as a myeloid downregulatory signal. Mouse studies of a related gene suggest that this interaction may control myeloid function in a tissue-specific manner. Alternative splicing of this gene results in multiple transcript variants.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu
Applications: Flow, IHC, ICC
Species: Hu
Applications: WB

Publications for CD200 R1 Antibody (NBP1-68990) (0)

There are no publications for CD200 R1 Antibody (NBP1-68990).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD200 R1 Antibody (NBP1-68990) (0)

There are no reviews for CD200 R1 Antibody (NBP1-68990). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD200 R1 Antibody (NBP1-68990) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CD200 R1 Antibody Products

Related Products by Gene

Bioinformatics Tool for CD200 R1 Antibody (NBP1-68990)

Discover related pathways, diseases and genes to CD200 R1 Antibody (NBP1-68990). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD200 R1 Antibody (NBP1-68990)

Discover more about diseases related to CD200 R1 Antibody (NBP1-68990).

Pathways for CD200 R1 Antibody (NBP1-68990)

View related products by pathway.

PTMs for CD200 R1 Antibody (NBP1-68990)

Learn more about PTMs related to CD200 R1 Antibody (NBP1-68990).

Blogs on CD200 R1

There are no specific blogs for CD200 R1, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol CD200R1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-68990 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought