CD200 R1 Antibody

Images

 
Western Blot: CD200R Antibody [NBP1-68990] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD200 R1 Antibody Summary

Immunogen
Synthetic peptides corresponding to CD200R1 (CD200 receptor 1) The peptide sequence was selected from the N terminal of CD200R1. Peptide sequence NLIIITWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD200R1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CD200R1 and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CD200 R1 Antibody

  • CD200 R1
  • CD200 receptor 1
  • CD200R1
  • CD200RMOX2Rcell surface glycoprotein CD200 receptor 1
  • Cell surface glycoprotein OX2 receptor 1
  • cell surface glycoprotein receptor CD200
  • CRTR2
  • HCRTR2
  • MOX2 receptor
  • MOX2R
  • OX2RCD200 cell surface glycoprotein receptor

Background

This gene encodes a receptor for the OX-2 membrane glycoprotein. Both the receptor and substrate are cell surface glycoproteins containing two immunoglobulin-like domains. This receptor is restricted to the surfaces of myeloid lineage cells and the receptor-substrate interaction may function as a myeloid downregulatory signal. Mouse studies of a related gene suggest that this interaction may control myeloid function in a tissue-specific manner. Alternative splicing of this gene results in multiple transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2724
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
MAB763
Species: Hu, Mu, Rt
Applications: IHC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-00948
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-68990
Species: Hu
Applications: WB

Publications for CD200 R1 Antibody (NBP1-68990) (0)

There are no publications for CD200 R1 Antibody (NBP1-68990).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD200 R1 Antibody (NBP1-68990) (0)

There are no reviews for CD200 R1 Antibody (NBP1-68990). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD200 R1 Antibody (NBP1-68990) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD200 R1 Products

Bioinformatics Tool for CD200 R1 Antibody (NBP1-68990)

Discover related pathways, diseases and genes to CD200 R1 Antibody (NBP1-68990). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD200 R1 Antibody (NBP1-68990)

Discover more about diseases related to CD200 R1 Antibody (NBP1-68990).
 

Pathways for CD200 R1 Antibody (NBP1-68990)

View related products by pathway.

PTMs for CD200 R1 Antibody (NBP1-68990)

Learn more about PTMs related to CD200 R1 Antibody (NBP1-68990).

Blogs on CD200 R1

There are no specific blogs for CD200 R1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD200 R1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD200R1
Entrez
Uniprot