Recombinant Human CD164 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related CD164 Peptides and Proteins

Order Details


    • Catalog Number
      H00008763-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human CD164 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-197 of Human CD164 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
CD164

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD164 Protein

  • CD164 antigen
  • CD164 molecule, sialomucin
  • CD164
  • Endolyn
  • MGC-24
  • MGC-24v
  • MUC-24
  • Multi-glycosylated core protein 24
  • sialomucin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF932
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF1172
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB5756
Species: Hu
Applications: Flow
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB100-78039
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-CS
H00008763-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for CD164 Recombinant Protein (H00008763-P01) (0)

There are no publications for CD164 Recombinant Protein (H00008763-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD164 Recombinant Protein (H00008763-P01) (0)

There are no reviews for CD164 Recombinant Protein (H00008763-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD164 Recombinant Protein (H00008763-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD164 Products

Bioinformatics Tool for CD164 Recombinant Protein (H00008763-P01)

Discover related pathways, diseases and genes to CD164 Recombinant Protein (H00008763-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD164 Recombinant Protein (H00008763-P01)

Discover more about diseases related to CD164 Recombinant Protein (H00008763-P01).
 

Pathways for CD164 Recombinant Protein (H00008763-P01)

View related products by pathway.

PTMs for CD164 Recombinant Protein (H00008763-P01)

Learn more about PTMs related to CD164 Recombinant Protein (H00008763-P01).

Blogs on CD164

There are no specific blogs for CD164, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CD164 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CD164
Entrez