Recombinant Human CD15/Lewis X Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CD15/Lewis X Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-99 of Human FUT4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ITYACWGQLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDL

Protein/Peptide Type
Partial Recombinant Protein
Gene
FUT4

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD15/Lewis X Protein

  • CD 15
  • CD15
  • CD-15
  • Lewis X
  • Lewis-X
  • LeX
  • SSEA-1
  • stage-specific embryonic antigen 1

Background

FUT4 catalyzes the synthesis of the non-sialylated antigen, Lewis x (CD15). It has been detected in human embryos (5-10 weeks) suggesting a role in development. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-46157
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-42795
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, CyTOF-ready

Publications for CD15/Lewis X Partial Recombinant Protein (H00002526-Q01) (0)

There are no publications for CD15/Lewis X Partial Recombinant Protein (H00002526-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD15/Lewis X Partial Recombinant Protein (H00002526-Q01) (0)

There are no reviews for CD15/Lewis X Partial Recombinant Protein (H00002526-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD15/Lewis X Partial Recombinant Protein (H00002526-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD15/Lewis X Products

CD15/Lewis X H00002526-Q01

Bioinformatics Tool for CD15/Lewis X Partial Recombinant Protein (H00002526-Q01)

Discover related pathways, diseases and genes to CD15/Lewis X Partial Recombinant Protein (H00002526-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD15/Lewis X Partial Recombinant Protein (H00002526-Q01)

Discover more about diseases related to CD15/Lewis X Partial Recombinant Protein (H00002526-Q01).
 

Pathways for CD15/Lewis X Partial Recombinant Protein (H00002526-Q01)

View related products by pathway.

PTMs for CD15/Lewis X Partial Recombinant Protein (H00002526-Q01)

Learn more about PTMs related to CD15/Lewis X Partial Recombinant Protein (H00002526-Q01).
 

Research Areas for CD15/Lewis X Partial Recombinant Protein (H00002526-Q01)

Find related products by research area.

Blogs on CD15/Lewis X

There are no specific blogs for CD15/Lewis X, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD11b Antibody
NB110-89474

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CD15/Lewis X Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FUT4