CD117/c-kit Antibody (X1)

Images

 
Western Blot: CD117/c-kit Antibody (X1) [H00003815-M10] - Analysis of KIT expression in transfected 293T cell line by KIT monoclonal antibody (M10), clone x1. Lane 1: KIT transfected lysatE (109.865 KDa). Lane 2: ...read more
Immunohistochemistry-Paraffin: CD117/c-kit Antibody (X1) [H00003815-M10] - Analysis of monoclonal antibody to KIT on formalin-fixed paraffin-embedded human stomach carcinoma. Antibody concentration 1.5 ug/ml
Sandwich ELISA: CD117/c-kit Antibody (X1) [H00003815-M10] - Detection limit for recombinant GST tagged KIT is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related CD117/c-kit Primary Antibodies

Order Details


    • Catalog Number
      H00003815-M10
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CD117/c-kit Antibody (X1) Summary

Immunogen
KIT (NP_000213, 41 a.a. - 140 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTD
Marker
Hematopoietic Stem Cell Marker
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KIT
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
This antibody is useful for ELISA, WB and IHC-P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD117/c-kit Antibody (X1)

  • CD117 antigen
  • CD117
  • ckit
  • c-kit
  • EC 2.7.10
  • EC 2.7.10.1
  • KIT
  • PBT
  • piebald trait
  • Proto-oncogene c-Kit
  • proto-oncogene tyrosine-protein kinase Kit
  • SCF R
  • SCFR
  • SCFRmast/stem cell growth factor receptor
  • soluble KIT variant 1
  • Tyrosine-protein kinase Kit
  • v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
  • v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF385
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
H00003815-M10
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for CD117/c-kit Antibody (H00003815-M10) (0)

There are no publications for CD117/c-kit Antibody (H00003815-M10).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD117/c-kit Antibody (H00003815-M10) (0)

There are no reviews for CD117/c-kit Antibody (H00003815-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD117/c-kit Antibody (H00003815-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD117/c-kit Products

Bioinformatics Tool for CD117/c-kit Antibody (H00003815-M10)

Discover related pathways, diseases and genes to CD117/c-kit Antibody (H00003815-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD117/c-kit Antibody (H00003815-M10)

Discover more about diseases related to CD117/c-kit Antibody (H00003815-M10).
 

Pathways for CD117/c-kit Antibody (H00003815-M10)

View related products by pathway.

PTMs for CD117/c-kit Antibody (H00003815-M10)

Learn more about PTMs related to CD117/c-kit Antibody (H00003815-M10).
 

Research Areas for CD117/c-kit Antibody (H00003815-M10)

Find related products by research area.

Blogs on CD117/c-kit.

Do you see what I see? I c-Kit
The c-Kit (CD117) proto-oncogene is a 145 kD receptor tyrosine kinase family closely related to platelet-derived growth factor receptor (PDGFR). It is a transmembrane receptor and the cellular homolog of the HZ4-feline sarcoma virus transforming gene...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD117/c-kit Antibody (X1) and receive a gift card or discount.

Bioinformatics

Gene Symbol KIT
Entrez
Uniprot