CD109 Antibody

Images

 
Immunohistochemistry-Paraffin: CD109 Antibody [NBP1-84393] - Staining of human parathyroid gland shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD109 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GPVEILTTVTESVTGISRNVSTNVFFKQHDYIIEFFDYTTVLKPSLNFTATVKVTRADGNQLTLEERRNNVVITVTQRNYTEYWSGSNSGNQKMEAVQKINYTVPQSGTFKIEFPILEDSSELQLKAYFLGSKSSMA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD109
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD109 Protein (NBP1-84393PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD109 Antibody

  • 150 kDa TGF-beta-1-binding protein
  • activated T-cell marker CD109
  • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 7
  • CD109 antigen (Gov platelet alloantigens)
  • CD109 antigen
  • CD109 molecule
  • CD109
  • CPAMD7
  • CPAMD7r150
  • DKFZp762L1111
  • FLJ38569
  • FLJ41966
  • Gov platelet alloantigens
  • p180
  • Platelet-specific Gov antigen
  • RP11-525G3.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
H00010714-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
NB200-351
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-02148
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85085
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59722
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for CD109 Antibody (NBP1-84393) (0)

There are no publications for CD109 Antibody (NBP1-84393).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD109 Antibody (NBP1-84393) (0)

There are no reviews for CD109 Antibody (NBP1-84393). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD109 Antibody (NBP1-84393) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD109 Products

Bioinformatics Tool for CD109 Antibody (NBP1-84393)

Discover related pathways, diseases and genes to CD109 Antibody (NBP1-84393). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD109 Antibody (NBP1-84393)

Discover more about diseases related to CD109 Antibody (NBP1-84393).
 

Pathways for CD109 Antibody (NBP1-84393)

View related products by pathway.

PTMs for CD109 Antibody (NBP1-84393)

Learn more about PTMs related to CD109 Antibody (NBP1-84393).

Blogs on CD109

There are no specific blogs for CD109, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD109 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD109
Entrez